<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11957
| Description |
mediator of RNA polymerase II transcription subunit 28 |
| Sequence | MASGGENLIDEFEAAFQTCFSSILNQDHFNGVDSDETKTGVELSIQKFLDVAKQNEAWFIQKRMLLSVHKPEQIIMEETQDLKKELIRKEQLIQKHYEKLLQWQSMLRDGISGAQTSMPAGQQQQQQPHQPSTPAASQTPGGQQSQGQMYPHGPLAYLEQTMSNIR |
| Length | 166 |
| Position | Head |
| Organism | Lingula unguis |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Brachiopoda> Linguliformea>
Lingulata> Lingulida> Linguloidea> Lingulidae> Lingula.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.731 |
| Instability index | 57.65 |
| Isoelectric point | 5.32 |
| Molecular weight | 18802.92 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP11957
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.41| 18| 20| 114| 131| 1
---------------------------------------------------------------------------
114- 131 (37.29/21.31) AQTSMPAGQQQQQQ..PHQP
135- 154 (32.12/17.34) AASQTPGGQQSQGQmyPHGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.20| 11| 24| 59| 69| 2
---------------------------------------------------------------------------
59- 69 (18.94/12.50) FIQKRMLLSVH
86- 96 (18.25/11.84) LIRKEQLIQKH
---------------------------------------------------------------------------
|