<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11948

Description mediator of RNA polymerase II transcription subunit 12-like protein
SequenceMLVLCGTRVNQLEPEHRGVWLVAPLIAKLPSSVQGRVLRSAGQVLESGNNFWSSKNKSEKDRSLQKSTSLLSHQPFLSLVLSCLKGQDEQREGLLTSLHSQLEKFVNNAKEGKFPEDSKTQQIVEEALQLRLSLAGGMFDTIQRNSQATTDWAVLLLQLVCNGVIDTQNNSDLFYTVLDMLSSLIHGSLVTDNSDSKDDGRKMWNLLSRKLRKELGDKYSDGIAQVRQLLPMSKSMCEVITCEPHGSLVDTKGNKIAGFDSIDKKQGLQVAMKVSVSPWDLLEGHKNPAPLSWPWFGAVKTERKPLKYEDHHRLMLYHTHNLYKSWSYYLDPPQLPPEELEPPPEKQPEEKPVEKPPEEEPKTKTTKPRRQRRASRVPSQTPYVTSPVRTGYSGYSSESYPGGPPPSWSLQQHPPYYSPQQLPPGGPRFPNSQSKAALSQMLRQRMPSSHSYPPLNSQAAMQNLQMLQKQRQQQMIRMQLRAQHGRNMQNNMERMYSNPNMQQQQPQLSVSGQQPLHHLPQQGLSQNYNNYGMQSQQTQMMEPALPPGGQVHNTPTPSTMMSPNFNQSYNSMQDQGMMNQPMRSQSSAGYMSMAAQGPPPQQNMYGQPNRMGPGMVNQGSLQGPGGPGGMSGGPGGISNQGTPMNAPGGIQNPGGPAPMAGYNQMGPSQPSQSSYMQNLPTPQHQQRLQQLRQQQQLLAMRQQQQQQQQTQQQQQTAQLVAQLQRQLTQQQQQNQQQPQYNSYQQPPPQY
Length750
PositionKinase
OrganismLingula unguis
KingdomMetazoa
LineageEukaryota> Metazoa> Spiralia> Lophotrochozoa> Brachiopoda> Linguliformea> Lingulata> Lingulida> Linguloidea> Lingulidae> Lingula.
Aromaticity0.06
Grand average of hydropathy-0.923
Instability index66.31
Isoelectric point9.42
Molecular weight84146.96
Publications









Function






Annotated function


GO - Cellular Component
GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP11948
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     101.31|      21|      21|     693|     713|       1
---------------------------------------------------------------------------
  404-  421 (33.19/ 7.80)	PPP...SWSLQQHPPYYSPQQ
  658-  678 (33.77/ 8.08)	PMAGYNQMGPSQPSQSSYMQN
  693-  713 (34.35/ 8.35)	QQQQLLAMRQQQQQQQQTQQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      63.24|      19|      19|     601|     619|       2
---------------------------------------------------------------------------
  558-  576 (25.03/ 6.05)	STMMSPNFNQSYNSMQDQG
  601-  619 (38.21/13.54)	QQNMYGQPNRMGPGMVNQG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      64.07|      22|      22|     424|     445|       4
---------------------------------------------------------------------------
  440-  462 (33.03/10.19)	Q....MLRQRmPSSHSYPPLNSQAAMQ
  513-  538 (31.04/ 9.07)	QqplhHLPQQ.GLSQNYNNYGMQSQQT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      96.54|      29|     230|     479|     515|       5
---------------------------------------------------------------------------
  479-  515 (42.45/29.51)	QLRAQHGRNMQNNMERmysnpnmQQQQPQLSVSGqQP
  718-  746 (54.09/23.20)	QLVAQLQRQLTQQQQQ.......NQQQPQYNSYQ.QP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      73.16|      15|      57|     186|     200|       6
---------------------------------------------------------------------------
  186-  200 (26.93/22.39)	HGSLVTDNSDSKDDG
  208-  222 (22.52/17.37)	SRKLRKELGDKYSDG
  245-  258 (23.71/18.73)	HGSLV.DTKGNKIAG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|      80.18|      10|      98|     548|     557|       9
---------------------------------------------------------------------------
  548-  557 (20.17/ 8.03)	GGQVHNTPTP
  625-  634 (20.77/ 8.51)	GGPGGMSGGP
  635-  643 (18.99/ 7.10)	GG.ISNQGTP
  648-  656 (20.26/ 8.10)	GG.IQNPGGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      46.30|      15|      23|     132|     154|      10
---------------------------------------------------------------------------
  132-  147 (23.66/28.55)	LSLA.GGMFDTiQRNSQ
  157-  172 (22.65/ 6.16)	LQLVcNGVIDT.QNNSD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      59.37|      19|      23|      32|      51|      15
---------------------------------------------------------------------------
   32-   51 (27.22/19.44)	SVQGRVLRSAGQVLeSGNNF
   58-   76 (32.14/18.57)	SEKDRSLQKSTSLL.SHQPF
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP11948 with Med12 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) PQLPPEELEPPPEKQPEEKPVEKPPEEEPKTKTTKPRRQRRASRVPSQTPYVTSPVRTGYSGYSSESYPGGPPPSWSLQQHPPYYSPQQLPPGGPRFPNSQSKAALSQMLRQRMPSSHSYPPLNSQAAMQNLQMLQKQRQQQMIRMQLRAQHGRNMQNNMERMYSNPNMQQQQPQLSVSGQQPLHHLPQQGLSQNYNNYGMQSQQTQMMEPALPPGGQVHNTPTPSTMMSPNFNQSYNSMQDQGMMNQPMRSQSSAGYMSMAAQGPPPQQNMYGQPNRMGPGMVNQGSLQGPGGPGGMSGGPGGISNQGTPMNAPGGIQNPGGPAPMAGYNQMGPSQPSQSSYMQNLPTPQHQQRLQQLRQQQQLLAMRQQQQQQQQTQQQQQTAQLVAQLQRQLTQQQQQNQQQPQYNSYQQPPPQY
333
750










Molecular Recognition Features






MoRF SequenceStartStop




NANANA