<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11941

Description mediator of RNA polymerase II transcription subunit 12-like protein isoform X2
SequenceMFQNLDQWSLRMTWLELQLMFKQSNSSELSSLQDAVAKSTIEIFQQETENSLNNGNNSESDPQQLPRLEPEHRGVWLVAPLIAKLPSSVQGRVLRSAGQVLESGNNFWSSKNKSEKDRSLQKSTSLLSHQPFLSLVLSCLKGQDEQREGLLTSLHSQLEKFVNNAKEGKFPEDSKTQQIVEEALQLRLSLAGGMFDTIQRNSQATTDWAVLLLQLVCNGVIDTQNNSDLFYTVLDMLSSLIHGSLVTDNSDSKDDGRKMWNLLSRKLRKELGDKYSDGIAQVRQLLPMSKSMCEVITCEPHGSLVDTKGNKIAGFDSIDKKQGLQVAMKVSVSPWDLLEGHKNPAPLSWPWFGAVKTERKPLKYEDHHRLMLYHTHNLYKSWSYYLDPPQLPPEELEPPPEKQPEEKPVEKPPEEEPKTKTTKPRRQRRASRSPVRTGYSGYSSESYPGGPPPSWSLQQHPPYYSPQQLPPGGPRFPNSQSKAALSQMLRQRMPSSHSYPPLNSQAAMQNLQMLQKQRQQQMIRMQLRAQHGRNMQNNMERMYSNPNMQQQQPQLSVSGQQPLHHLPQQGLSQNYNNYGMQSQQTQMMEPALPPGGQVHNTPTPSTMMSPNFNQSYNSMQDQGMMNQPMRSQSSAGYMSMAAQGPPPQQNMYGQPNRMGPGMVNQGSLQGPGGPGGMSGGPGGISNQGTPMNAPGGIQNPGGPAPMAGYNQMGPSQPSQSSYMQNLPTPQHQQRLQQLRQQQQLLAMRQQQQQQQQTQQQQQTAQLVAQLQRQLTQQQQQNQQQPQYNSYQQPPPQY
Length797
PositionKinase
OrganismLingula unguis
KingdomMetazoa
LineageEukaryota> Metazoa> Spiralia> Lophotrochozoa> Brachiopoda> Linguliformea> Lingulata> Lingulida> Linguloidea> Lingulidae> Lingula.
Aromaticity0.06
Grand average of hydropathy-0.945
Instability index68.08
Isoelectric point9.16
Molecular weight89717.85
Publications









Function






Annotated function


GO - Cellular Component
GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP11941
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     130.42|      21|      21|     740|     760|       1
---------------------------------------------------------------------------
  451-  468 (33.19/ 7.95)	PPP...SWSLQQ..HPPYYSPQQ
  705-  725 (33.77/ 8.23)	PMAGYNQMGPSQ..PSQSSYMQN
  740-  760 (34.35/ 8.50)	QQQQLLAMRQQQ..QQQQQTQQQ
  762-  784 (29.11/ 6.02)	QTAQLVAQLQRQltQQQQQNQQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      80.56|      23|      24|     653|     676|       2
---------------------------------------------------------------------------
  626-  650 (34.85/10.12)	NQPMRsqSSAGYMSMAA.QGPPPQQN
  653-  676 (45.71/18.07)	GQPNR..MGPGMVNQGSlQGPGGPGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      77.43|      21|      23|     193|     213|       3
---------------------------------------------------------------------------
  193-  211 (30.56/18.26)	.......GMFDTIQRNSQATTD....WAVL
  212-  234 (25.21/13.86)	LLqlvcnGVIDT.QNNSDLF......YTVL
  236-  263 (21.66/10.94)	MLsslihGSL..VTDNSDSKDDgrkmWNLL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     243.44|      50|     199|     359|     408|       4
---------------------------------------------------------------------------
  359-  408 (98.01/35.51)	RKPLK..YEDHHRLMLYHTHNLYKSWSYY....................LDP..PQLPPEELE.................PPPEKQPEEKP
  432-  510 (32.57/ 6.87)	RSPVRtgYSG............YSSESYPggpppswslqqhppyyspqqLPPggPRFPNSQSKaalsqmlrqrmpsshsyPPLNSQAAMQN
  524-  556 (47.13/13.24)	RMQLR..AQ.HGRNMQNNMERMYSNPNMQ....................QQQ..PQLS.................................
  560-  602 (65.74/21.38)	QQPL......HH....LPQQGLSQNYNNY...................gMQS..QQTQMMEPA.................LPPGGQVHNTP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      97.19|      22|      23|      88|     109|       5
---------------------------------------------------------------------------
   31-   60 (26.41/14.24)	SLQDAVAKSTIEIfqqetensLNNGNNSES
   88-  109 (38.48/24.26)	SVQGRVLRSAGQV........LESGNNFWS
  114-  134 (32.30/19.13)	SEKDRSLQKSTSL........L.SHQPFLS
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP11941 with Med12 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) PQLPPEELEPPPEKQPEEKPVEKPPEEEPKTKTTKPRRQRRASRSPVRTGYSGYSSESYPGGPPPSWSLQQHPPYYSPQQLPPGGPRFPNSQSKAALSQMLRQRMPSSHSYPPLNSQAAMQNLQMLQKQRQQQMIRMQLRAQHGRNMQNNMERMYSNPNMQQQQPQLSVSGQQPLHHLPQQGLSQNYNNYGMQSQQTQMMEPALPPGGQVHNTPTPSTMMSPNFNQSYNSMQDQGMMNQPMRSQSSAGYMSMAAQGPPPQQNMYGQPNRMGPGMVNQGSLQGPGGPGGMSGGPGGISNQGTPMNAPGGIQNPGGPAPMAGYNQMGPSQPSQSSYMQNLPTPQHQQRLQQLRQQQQLLAMRQQQQQQQQTQQQQQTAQLVAQLQRQLTQQQQQNQQQPQYNSYQQPPPQY
389
797










Molecular Recognition Features






MoRF SequenceStartStop




NANANA