<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11940

Description mediator of RNA polymerase II transcription subunit 12-like protein isoform X1
SequenceMFQNLDQWSLRMTWLELQLMFKQSNSSELSSLQDAVAKSTIEIFQQETENSLNNGNNSESDPQQLPRLEPEHRGVWLVAPLIAKLPSSVQGRVLRSAGQVLESGNNFWSSKNKSEKDRSLQKSTSLLSHQPFLSLVLSCLKGQDEQREGLLTSLHSQLEKFVNNAKEGKFPEDSKTQQIVEEALQLRLSLAGGMFDTIQRNSQATTDWAVLLLQLVCNGVIDTQNNSDLFYTVLDMLSSLIHGSLVTDNSDSKDDGRKMWNLLSRKLRKELGDKYSDGIAQVRQLLPMSKSMCEVITCEPHGSLVDTKGNKIAGFDSIDKKQGLQVAMKVSVSPWDLLEGHKNPAPLSWPWFGAVKTERKPLKYEDHHRLMLYHTHNLYKSWSYYLDPPQLPPEELEPPPEKQPEEKPVEKPPEEEPKTKTTKPRRQRRASRVPSQTPYVTSPVRTGYSGYSSESYPGGPPPSWSLQQHPPYYSPQQLPPGGPRFPNSQSKAALSQMLRQRMPSSHSYPPLNSQAAMQNLQMLQKQRQQQMIRMQLRAQHGRNMQNNMERMYSNPNMQQQQPQLSVSGQQPLHHLPQQGLSQNYNNYGMQSQQTQMMEPALPPGGQVHNTPTPSTMMSPNFNQSYNSMQDQGMMNQPMRSQSSAGYMSMAAQGPPPQQNMYGQPNRMGPGMVNQGSLQGPGGPGGMSGGPGGISNQGTPMNAPGGIQNPGGPAPMAGYNQMGPSQPSQSSYMQNLPTPQHQQRLQQLRQQQQLLAMRQQQQQQQQTQQQQQTAQLVAQLQRQLTQQQQQNQQQPQYNSYQQPPPQY
Length806
PositionKinase
OrganismLingula unguis
KingdomMetazoa
LineageEukaryota> Metazoa> Spiralia> Lophotrochozoa> Brachiopoda> Linguliformea> Lingulata> Lingulida> Linguloidea> Lingulidae> Lingula.
Aromaticity0.06
Grand average of hydropathy-0.936
Instability index67.49
Isoelectric point9.15
Molecular weight90690.93
Publications









Function






Annotated function


GO - Cellular Component
GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP11940
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     101.31|      21|      21|     749|     769|       1
---------------------------------------------------------------------------
  460-  477 (33.19/ 6.92)	PPP...SWSLQQHPPYYSPQQ
  714-  734 (33.77/ 7.16)	PMAGYNQMGPSQPSQSSYMQN
  749-  769 (34.35/ 7.40)	QQQQLLAMRQQQQQQQQTQQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      63.24|      19|      19|     657|     675|       2
---------------------------------------------------------------------------
  614-  632 (25.03/ 6.26)	STMMSPNFNQSYNSMQDQG
  657-  675 (38.21/13.89)	QQNMYGQPNRMGPGMVNQG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      64.07|      22|      22|     480|     501|       4
---------------------------------------------------------------------------
  496-  518 (33.03/ 8.55)	Q....MLRQRmPSSHSYPPLNSQAAMQ
  569-  594 (31.04/ 7.60)	QqplhHLPQQ.GLSQNYNNYGMQSQQT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      69.13|      24|      57|      30|      61|       5
---------------------------------------------------------------------------
   30-   61 (34.14/37.33)	SSLQDAVAKSTIEIfqqetensLNNGNN.......SESD
   87-  117 (34.98/20.55)	SSVQGRVLRSAGQV........LESGNNfwssknkSEKD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      73.16|      15|      57|     242|     256|       6
---------------------------------------------------------------------------
  242-  256 (26.93/18.39)	HGSLVTDNSDSKDDG
  264-  278 (22.52/14.26)	SRKLRKELGDKYSDG
  301-  314 (23.71/15.38)	HGSLV.DTKGNKIAG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      96.54|      29|     230|     535|     571|       7
---------------------------------------------------------------------------
  535-  571 (42.45/26.93)	QLRAQHGRNMQNNMERmysnpnmQQQQPQLSVSGqQP
  774-  802 (54.09/21.16)	QLVAQLQRQLTQQQQQ.......NQQQPQYNSYQ.QP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.51|      11|      98|     599|     613|      10
---------------------------------------------------------------------------
  602-  613 (20.25/15.58)	PPGGqVHNTPTP
  702-  712 (24.26/ 6.06)	APGG.IQNPGGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      46.30|      15|      23|     188|     210|      11
---------------------------------------------------------------------------
  188-  203 (23.66/32.09)	LSLA.GGMFDTiQRNSQ
  213-  228 (22.65/ 6.77)	LQLVcNGVIDT.QNNSD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.19|      14|      36|     638|     654|      16
---------------------------------------------------------------------------
  638-  654 (22.02/14.77)	MRSQSSAGYMSmaaQGP
  677-  690 (29.17/12.51)	LQGPGGPGGMS...GGP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP11940 with Med12 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) PQLPPEELEPPPEKQPEEKPVEKPPEEEPKTKTTKPRRQRRASRVPSQTPYVTSPVRTGYSGYSSESYPGGPPPSWSLQQHPPYYSPQQLPPGGPRFPNSQSKAALSQMLRQRMPSSHSYPPLNSQAAMQNLQMLQKQRQQQMIRMQLRAQHGRNMQNNMERMYSNPNMQQQQPQLSVSGQQPLHHLPQQGLSQNYNNYGMQSQQTQMMEPALPPGGQVHNTPTPSTMMSPNFNQSYNSMQDQGMMNQPMRSQSSAGYMSMAAQGPPPQQNMYGQPNRMGPGMVNQGSLQGPGGPGGMSGGPGGISNQGTPMNAPGGIQNPGGPAPMAGYNQMGPSQPSQSSYMQNLPTPQHQQRLQQLRQQQQLLAMRQQQQQQQQTQQQQQTAQLVAQLQRQLTQQQQQNQQQPQYNSYQQPPPQY
389
806










Molecular Recognition Features






MoRF SequenceStartStop




1) QQPPPQ
800
805