<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11914
Description |
Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MAAPGTKQVLLSLIEDVEIITKELFELMSAKKTETSTEPVADTGQLMELLLKKDAEIQAALKTATEQGEVQKKIEALQVEVDRRDADILQLQKNLKEAETILATAIYQAKQKLTSIKQANQKSIPSEELIKYAHKISSSHAVAAPNTWQPGDPRRPYPTELDMRMGFLGRLNNPNFQSQPGLGADPQLSRQPGQLDHTPSHAVYNIDIFLT |
Length | 211 |
Position | Middle |
Organism | Lingula unguis |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Brachiopoda> Linguliformea>
Lingulata> Lingulida> Linguloidea> Lingulidae> Lingula.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.476 |
Instability index | 50.62 |
Isoelectric point | 5.64 |
Molecular weight | 23411.44 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP11914
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 80.03| 28| 28| 30| 57| 1
---------------------------------------------------------------------------
30- 57 (43.36/26.02) AKKTETSTEPVADTGQLMELLL.KKDAEI
60- 88 (36.66/21.11) ALKTATEQGEVQKKIEALQVEVdRRDADI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.92| 11| 31| 152| 162| 3
---------------------------------------------------------------------------
152- 162 (22.50/12.78) DPR.RPYPTELD
185- 196 (17.41/ 8.51) DPQlSRQPGQLD
---------------------------------------------------------------------------
|