Description | Mediator of RNA polymerase II transcription subunit 17 |
Sequence | MSGVRAVRISIESACEKQVQEVGLDGTETYLQPLSMSQNLARLAQRIDFSQGSGSEEEEAAGPEGDAPDWPGAGADQDDEEGLVKFQPSLWPWDSVRNNLRSALTEMCVLYDVLSIVRDKKFMTLDPVSQDAIPPKQNPQTLQLISKKKSLAGAAQILLKGAERLTKSVTENQESKLQRDFNSELLRLRQHWKLKIVXDKILRDLSYRSAGSLFPHHGTFEVIKNTDIDLDKKIPEDYCPLDVQIPSDLEGSAYIKVSIQKQAPDIGDLGTVNLFKRPLPKSKPGSPHWQMKLEAAQNVLLCKEIFSQLSREAVQIKSQIPHIVVKNQIISQPFPSLQLSISLCHSSNDKKSQKSASEKQSAEDHLYVLEHNLHLLIREFHKQTLSSVMMPHPASAPFGHKRMRLSGPQAFDKNEINSLQSSEGLLEKIIKQAKHIFLRNRTAATIDSLSSRIEDPQIQAHWSNINDVYESSVKVLITSQGYEQICKSIQLQLNVGVEQIRVVHRDGRVITLSHQEQELQDFLLSQMSQHQVHAVQQLAKVMGWQVLSFSNHVGLGPVESIGNASAITVASPSGDYAISVRNGPESGSKVLVQFPRIQCKDLPKSDVLQDSKWSHLRGPFREVQWNKMEGRNFVYKMELLMSALSPCLL |
Length | 649 |
Position | Head |
Organism | Dipodomys ordii (Ord's kangaroo rat) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Glires> Rodentia> Castorimorpha> Heteromyidae> Dipodomyinae> Dipodomys. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.405 |
Instability index | 53.17 |
Isoelectric point | 7.06 |
Molecular weight | 72590.98 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364140 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP11889 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 200.54| 51| 110| 278| 328| 1 --------------------------------------------------------------------------- 278- 328 (90.32/49.45) PLPKSKP.GSPHW...QMKLEAAQNVLL........CKEIFSQLSREAV..QIKSQIPHIVVKNQ 391- 441 (70.71/37.32) PHPASAPfG..HK...RMRLSGPQ.AFD........KNEINSLQSSEGLleKIIKQAKHIFLRNR 452- 501 (39.51/18.03) RIEDPQI..QAHWsniNDVYESSVKVLItsqgyeqiCKSIQLQLNVGVE..QIR........... --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 198.60| 69| 339| 173| 246| 2 --------------------------------------------------------------------------- 173- 246 (103.39/87.30) QESKLQrDFnsELLRLRQHwKLKIVxD..KIL..RDLSYRSAGSLFPHH..GTFEVIKNTDIDLDKKI.....PEDYCPLDVQIP 515- 595 (95.21/63.97) QEQELQ.DF..LLSQMSQH.QVHAVqQlaKVMgwQVLSFSNHVGLGPVEsiGNASAITVASPSGDYAIsvrngPESGSKVLVQFP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 62.72| 18| 18| 54| 71| 4 --------------------------------------------------------------------------- 54- 71 (33.54/15.96) GSEEEEAAG.PEGDAPDWP 74- 92 (29.18/13.16) GADQDDEEGlVKFQPSLWP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) LWAEL 2) MEIIGRLVWRRL | 201 176 | 205 187 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab