<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11887
Description |
mediator of RNA polymerase II transcription subunit 22 isoform X2 |
Sequence | MAQQRALPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAIDQRSQQLRALQEECDRKLVALRDEVSIDLYELEEEYYSSSSSLCEANDLPLCEAYWRLDLDTDSADGLPAPLLASPEPGPGSLPAAAPSHSHAGGPGPTEHT |
Length | 200 |
Position | Head |
Organism | Dipodomys ordii (Ord's kangaroo rat) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Castorimorpha> Heteromyidae>
Dipodomyinae> Dipodomys.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.575 |
Instability index | 65.44 |
Isoelectric point | 4.56 |
Molecular weight | 22217.49 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP11887
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.10| 17| 17| 132| 148| 1
---------------------------------------------------------------------------
132- 148 (30.17/19.56) EEYYSSSSSLCEANDLP
151- 167 (30.93/20.22) EAYWRLDLDTDSADGLP
---------------------------------------------------------------------------
|