<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11886
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPPGGGPGAAPPPAATAAPPGADKSAAGCGPFYLMRELPGSTELTGSTNLITHYKLEHDYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILGGSFNPITGTMLSGFRLHTGPLPEQCRLMHIQPPKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKKKKKEKKKKKNRHSPDHPGMGSSQASSSSSLR |
| Length | 243 |
| Position | Head |
| Organism | Dipodomys ordii (Ord's kangaroo rat) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Castorimorpha> Heteromyidae>
Dipodomyinae> Dipodomys.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.015 |
| Instability index | 63.16 |
| Isoelectric point | 9.76 |
| Molecular weight | 26133.63 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:Ensembl
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP11886
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.55| 16| 16| 14| 29| 1
---------------------------------------------------------------------------
14- 29 (37.09/12.78) PPPPPTALGFGPGKPP
31- 46 (37.46/12.99) PPPPPPGGGPGAAPPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 80.86| 16| 17| 189| 204| 2
---------------------------------------------------------------------------
170- 183 (26.37/10.38) P..PKKNKHKHKQSRT
189- 204 (28.02/11.42) PETPSDSDHKKKKKKK
208- 223 (26.48/10.45) PERKKKKKEKKKKKNR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 88.20| 20| 113| 110| 130| 3
---------------------------------------------------------------------------
110- 130 (36.72/22.79) PDLPGMIdLPGSHDN.......SSLR....SL
132- 159 (19.40/ 6.45) EKPP..I.LGGSF.NpitgtmlSGFRlhtgPL
226- 242 (32.08/15.31) PDHPGM....GSSQA.......SSSS....SL
---------------------------------------------------------------------------
|