<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11866

Description mediator of RNA polymerase II transcription subunit 27 isoform X1
SequenceMADVLSVGVNLEAFAQAINAIQALRSSVSRVFDCLKDGMRNKETLEGREKAFIAQFQDNLHSVNRDLNELERLSNLVGKPSENHPLHNSGLLSLDPVQDKTPLYSQLLQAYKWSNKLQYHAGLASGLLNQQSLKRSANQMGVSAKRRPKSQPTTLVLPPQYVDDVISRIDRMFPEMSIHLSRPNGTSAMLLVTLGKVLKVIVVMRSLFIDRTIVKGYNENVYTEGGKLDIWSKSSFQVFQKVTDHATTALLHYQLPQMPDVVVRSFMTWLRSYIKLFQAPCQRCGKFLQDGLPPTWRDFRTLEAFHDTCRQ
Length311
PositionTail
OrganismDipodomys ordii (Ord's kangaroo rat)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Glires> Rodentia> Castorimorpha> Heteromyidae> Dipodomyinae> Dipodomys.
Aromaticity0.08
Grand average of hydropathy-0.292
Instability index40.91
Isoelectric point9.47
Molecular weight35291.25
Publications

Function

Annotated function
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
GO - Biological Process
stem cell population maintenance	GO:0019827	IEA:Ensembl

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP11866
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     104.20|      32|      33|     147|     178|       1
---------------------------------------------------------------------------
  147-  178 (55.39/41.76)	RPKSQPTTLVLPPQYVDDVISRIDRMFPEMSI
  182-  213 (48.82/35.96)	RPNGTSAMLLVTLGKVLKVIVVMRSLFIDRTI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      60.14|      16|     230|      56|      71|       3
---------------------------------------------------------------------------
   56-   71 (28.66/17.20)	FQDNLHSVNRDLNELE
  288-  303 (31.48/19.50)	LQDGLPPTWRDFRTLE
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP11866 with Med27 domain of Kingdom Metazoa

Unable to open file!