<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11825

Description mediator of RNA polymerase II transcription subunit 8-like isoform X1
SequenceMINILFFITDYLFVVKLRRVEREEQLWGLGQCGRKGETKKGRRMEGELVQQQQERLNQAVQQQLNLEQVKMRAISLFKAISRILEDFDAYARTNTTPKWQDILGQYSMVNLELFNIVDDIKKVSKPFLVYPKNVNADNATILPVMLSTKLLPEMETEDTSKRDQLLQGMQNLPIATQIDKLKARLDMIAGACEGAEKVLADTRKAYCFGTRQGPAIAPALDKGQAAKIQEQENLLRAAVNVGEGLRIPGDQRHITASLPMHLADVFTVNEGAQSFPEGSSNNAYMKNTPLSSNSMGGQNSLLQTSGSQLLGRSAASPNVATSATFDNTAASPIPYANSPRSSTNMMNTPSPQQQTSQQQQQQPTVQQQQRQKMMQLPQQQQQLLAQQQQFRQSAMQGLGQLHGQHQMQFSQQIGHQQFQGRQLTSGHVQHGIGQSQLNQGNQMTRISQFSGAANNALFSAAQTTPNTQMIPNISAGISSQSLLPRMQFGLSGNNPQRNHASQMLNDQMFSMGGGNPGGMMSIQQQQQQQQSSQGAFGGMASNAQNLQSGMMTLQNTQQNHPNFSQQRQQNQQ
Length572
PositionHead
OrganismCicer arietinum (Chickpea) (Garbanzo)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> Hologalegina> IRL clade> Cicereae> Cicer.
Aromaticity0.05
Grand average of hydropathy-0.655
Instability index54.43
Isoelectric point9.49
Molecular weight63304.60
Publications
PubMed=26259924

Function

Annotated function 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP11825
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      90.50|      19|      19|     358|     376|       1
---------------------------------------------------------------------------
  358-  375 (34.08/11.07)	..QQQQQPTVQQ..QQ.RQKMMQ
  376-  396 (28.61/ 8.09)	LpQQQQQLLAQQ..QQfRQSAMQ
  553-  572 (27.81/ 7.65)	L.QNTQQ.NHPNfsQQ.RQQNQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      79.02|      16|      19|     479|     495|       2
---------------------------------------------------------------------------
  307-  317 (18.47/ 6.39)	SQ.LLGR.....SAASP
  479-  495 (27.23/17.77)	SQSLLPRMqFGLSGNNP
  501-  516 (33.31/17.67)	SQMLNDQM.FSMGGGNP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      79.82|      17|      18|     408|     424|       3
---------------------------------------------------------------------------
  408-  424 (31.11/13.85)	QFSQQIGHQQF.QGRQLT
  427-  444 (25.07/ 9.67)	HVQHGIGQSQLnQGNQMT
  448-  464 (23.64/ 8.68)	QFSGAANNALF.SAAQTT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      36.84|      11|      16|     322|     334|       7
---------------------------------------------------------------------------
  322-  334 (14.93/14.62)	SATfdNTAASPIP
  341-  351 (21.91/12.66)	SST..NMMNTPSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      59.36|      19|      19|     219|     237|       8
---------------------------------------------------------------------------
  212-  230 (29.89/16.78)	QGPAIAPALDKGQAAKIQE
  231-  249 (29.48/16.46)	QENLLRAAVNVGEGLRIPG
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP11825 with Med8 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) FTVNEGAQSFPEGSSNNAYMKNTPLSSNSMGGQNSLLQTSGSQLLGRSAASPNVATSATFDNTAASPIPYANSPRSSTNMMNTPSPQQQTSQQQQQQPTVQQQQRQKMMQLPQQQQQLLAQQQQFRQSAMQGLGQLHGQHQMQFSQQIGHQQFQGRQLTSGHVQHGIGQSQLNQGNQMTRISQFSGAANNALFSAAQTTPNTQMIPNISAGIS
2) SLLPRMQFGLSGNNPQRNHASQMLNDQMFSMGGGNPGGMMSIQQQQQQQQSSQGAFGGMASNAQNLQSGMMTLQNTQQNHPNFSQQRQQNQQ
266
481
478
572










Molecular Recognition Features






MoRF SequenceStartStop




NANANA