<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11822
| Description |
mediator of RNA polymerase II transcription subunit 30 |
| Sequence | MSGPPHTFQSSFANAQQRCQFNSQPGLINPQQPGIVNTFGGSTTSVGVGMQGQVSQPGQMQQNQQQTQQTQIGVQATGNVNQGVRTAATDNTNQPGPPQGPPQPAKTTEFNTASLCKFGQETVMDIVSRTQEVFQILKTIQPPNGTVSVLNASNDKRAKTQEQLKTIKLLFKRLRLIYEKCNECCQVQGMEYTHIEGLIPIKEDWDMKSDEKKTSEQYR |
| Length | 218 |
| Position | Head |
| Organism | Diaphorina citri (Asian citrus psyllid) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Paraneoptera> Hemiptera> Sternorrhyncha> Psylloidea> Liviidae>
Diaphorina.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.772 |
| Instability index | 38.63 |
| Isoelectric point | 8.60 |
| Molecular weight | 24187.87 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP11822
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 79.67| 23| 23| 32| 54| 1
---------------------------------------------------------------------------
32- 54 (41.97/18.91) QPGIV..NTFGGSTTSVGVGMQGQV
56- 80 (37.70/16.35) QPGQMqqNQQQTQQTQIGVQATGNV
---------------------------------------------------------------------------
|