<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11819
Description |
mediator of RNA polymerase II transcription subunit 24-like |
Sequence | QDCTGKLCTFVTKLIKFNECSKQSNPSDTSKTAQTKVMLFDITFLMLCSIVQRYGSKVVFSENGGDSFFEKWVRDCMVEGGRPKPYKKMLDEKDQAGVDDLLRQFNSSDAEFKNCPKLNCYEICLNIPAVIYDVLGAWETSVLSSTDVKRILDAM |
Length | 155 |
Position | Tail |
Organism | Diaphorina citri (Asian citrus psyllid) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Paraneoptera> Hemiptera> Sternorrhyncha> Psylloidea> Liviidae>
Diaphorina.
|
Aromaticity | 0.10 |
Grand average of hydropathy | -0.246 |
Instability index | 39.51 |
Isoelectric point | 5.54 |
Molecular weight | 17511.99 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP11819
No repeats found
No repeats found
|