<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11814
| Description |
mediator of RNA polymerase II transcription subunit 23-like |
| Sequence | MSHMDEICDLLYHIKYMFVGDLMKSEVEGIIRKLRPALQMRLRFISHLNIDEIISNT |
| Length | 57 |
| Position | Tail |
| Organism | Diaphorina citri (Asian citrus psyllid) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Paraneoptera> Hemiptera> Sternorrhyncha> Psylloidea> Liviidae>
Diaphorina.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | 0.065 |
| Instability index | 66.81 |
| Isoelectric point | 6.24 |
| Molecular weight | 6778.98 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP11814
No repeats found
No repeats found
|