Description | mediator of RNA polymerase II transcription subunit 23-like |
Sequence | MSHMDEICDLLYHIKYMFVGDLMKSEVEGIIRKLRPALQMRLRFISHLNIDEIISNT |
Length | 57 |
Position | Tail |
Organism | Diaphorina citri (Asian citrus psyllid) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Paraneoptera> Hemiptera> Sternorrhyncha> Psylloidea> Liviidae> Diaphorina. |
Aromaticity | 0.07 |
Grand average of hydropathy | 0.065 |
Instability index | 66.81 |
Isoelectric point | 6.24 |
Molecular weight | 6778.98 |
Publications |
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP11814 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) IIRKLRP 2) RLRFISHLNIDEIIS | 30 41 | 36 55 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab