| Description | mediator of RNA polymerase II transcription subunit 23-like |
| Sequence | MSHMDEICDLLYHIKYMFVGDLMKSEVEGIIRKLRPALQMRLRFISHLNIDEIISNT |
| Length | 57 |
| Position | Tail |
| Organism | Diaphorina citri (Asian citrus psyllid) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Paraneoptera> Hemiptera> Sternorrhyncha> Psylloidea> Liviidae> Diaphorina. |
| Aromaticity | 0.07 |
| Grand average of hydropathy | 0.065 |
| Instability index | 66.81 |
| Isoelectric point | 6.24 |
| Molecular weight | 6778.98 |
| Publications |
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell |
| GO - Biological Function | |
| GO - Biological Process |
| Binary Interactions |
| Repeats | >MDP11814 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) IIRKLRP 2) RLRFISHLNIDEIIS | 30 41 | 36 55 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab