<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11812
| Description |
Mediator of RNA polymerase II transcription subunit 16 |
| Sequence | MEQRLIATGPAESLAAAIADPTVSDVDKVLLNLGAKEFTVEPSTLQSLQQLIQWIANLALNIVGRYAEHKKNNHYDIMSDSCVLNTLRELIVIIRIWGLLRSSCLPVFICCFDSLDVLATLYKLLSRMIHNKDVALTGLDESLVDECMVLQNQVVIPSLTQLYENVCDVANPLFYQTFAPLCMEYGSDPVSSYSEDCLLAPSPTSRQYTDIIRHVYLGRHPPLIKSCTRCGGRTQVLSMARTAAVRAWEGRWVQACRCGGHWNMNRAADKKSLLRDNI |
| Length | 278 |
| Position | Tail |
| Organism | Diaphorina citri (Asian citrus psyllid) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Paraneoptera> Hemiptera> Sternorrhyncha> Psylloidea> Liviidae>
Diaphorina.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | 0.055 |
| Instability index | 57.47 |
| Isoelectric point | 6.30 |
| Molecular weight | 31089.67 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364149
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP11812
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.24| 16| 27| 224| 243| 1
---------------------------------------------------------------------------
224- 243 (22.13/24.75) IKSCtRCGGRtqvLSMARTA
253- 268 (35.11/22.06) VQAC.RCGGH...WNMNRAA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 83.30| 26| 29| 163| 189| 2
---------------------------------------------------------------------------
163- 189 (46.90/36.86) YENVCDVA.NPLFYQtFAPLCME.Y.GSDP
193- 221 (36.41/23.25) YSEDCLLApSPTSRQ.YTDIIRHvYlGRHP
---------------------------------------------------------------------------
|