Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MMGDQYRKMEQYSPKTSPRGSRSPIVSRQDTTGTLKTTISLGKNPSIVHSGPFYLMKEPPGKSEKTGSVNLMASYGLEHTYNKFCGKKLKESLSSFLPNLPGIIDAPGSQDNSSLRSVIEKPPICGKEILPLTSVQLAGFRLHPGNLPEQYRIANQVASKRHKNKHKKHKYKTGDTSNPDANMGDVSYSDSHEKKHKKQKRHNDDKERKKRKKEKKKKNRIE |
Length | 222 |
Position | Head |
Organism | Diaphorina citri (Asian citrus psyllid) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Paraneoptera> Hemiptera> Sternorrhyncha> Psylloidea> Liviidae> Diaphorina. |
Aromaticity | 0.05 |
Grand average of hydropathy | -1.180 |
Instability index | 51.64 |
Isoelectric point | 10.00 |
Molecular weight | 25084.39 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP11808 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 87.93| 28| 38| 59| 95| 1 --------------------------------------------------------------------------- 59- 89 (47.15/44.58) P..PGKSEKTGSVNlmaSYGLEHTYNK..FCGKKL 98- 129 (40.78/19.57) PnlPGIIDAPGSQD...NSSLRSVIEKppICGKEI --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 63.25| 17| 28| 159| 175| 2 --------------------------------------------------------------------------- 159- 175 (31.75/16.24) SKRHKNKHKKHKYKTGD 189- 205 (31.51/16.07) SDSHEKKHKKQKRHNDD --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DKERKK 2) YRKMEQYSPKT | 205 6 | 210 16 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab