<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11808
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MMGDQYRKMEQYSPKTSPRGSRSPIVSRQDTTGTLKTTISLGKNPSIVHSGPFYLMKEPPGKSEKTGSVNLMASYGLEHTYNKFCGKKLKESLSSFLPNLPGIIDAPGSQDNSSLRSVIEKPPICGKEILPLTSVQLAGFRLHPGNLPEQYRIANQVASKRHKNKHKKHKYKTGDTSNPDANMGDVSYSDSHEKKHKKQKRHNDDKERKKRKKEKKKKNRIE |
| Length | 222 |
| Position | Head |
| Organism | Diaphorina citri (Asian citrus psyllid) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Paraneoptera> Hemiptera> Sternorrhyncha> Psylloidea> Liviidae>
Diaphorina.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.180 |
| Instability index | 51.64 |
| Isoelectric point | 10.00 |
| Molecular weight | 25084.39 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP11808
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 87.93| 28| 38| 59| 95| 1
---------------------------------------------------------------------------
59- 89 (47.15/44.58) P..PGKSEKTGSVNlmaSYGLEHTYNK..FCGKKL
98- 129 (40.78/19.57) PnlPGIIDAPGSQD...NSSLRSVIEKppICGKEI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.25| 17| 28| 159| 175| 2
---------------------------------------------------------------------------
159- 175 (31.75/16.24) SKRHKNKHKKHKYKTGD
189- 205 (31.51/16.07) SDSHEKKHKKQKRHNDD
---------------------------------------------------------------------------
|