<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11803
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MANKGGPETEDQQRLRFQIELEFIQCLANPNYLNFLAQRGYLKDEAFVNYLKYLLYWKEPQYAKYLKYPMCLYFLDLLQYEHFRREIVNSQCAKFIDDQQVLLWQHYTRKRTKLLNEAAQNNISGVGRDSLQNNGNGANNGTTIKSESQ |
| Length | 149 |
| Position | Middle |
| Organism | Diaphorina citri (Asian citrus psyllid) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Paraneoptera> Hemiptera> Sternorrhyncha> Psylloidea> Liviidae>
Diaphorina.
|
| Aromaticity | 0.13 |
| Grand average of hydropathy | -0.708 |
| Instability index | 39.35 |
| Isoelectric point | 8.37 |
| Molecular weight | 17616.72 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP11803
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.26| 14| 15| 23| 36| 1
---------------------------------------------------------------------------
23- 36 (26.92/15.30) FIQCLANPNYLNFL
41- 54 (24.34/13.29) YLKDEAFVNYLKYL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.63| 11| 15| 55| 65| 2
---------------------------------------------------------------------------
55- 65 (22.77/13.99) LYWKE.PQYAKY
72- 83 (16.85/ 8.76) LYFLDlLQYEHF
---------------------------------------------------------------------------
|