Description | Mediator of RNA polymerase II transcription subunit 11 |
Sequence | MERIQVLDQIEKDIITCLQSAGQALLELSKEKSSLKQAESQSHNFLKTLSHVETKLTEQINYLTQVSTGQPHEGSGYASQKVLQMAWHRLEHARSRVNELERVKNKYTRGQPGSTTPIKSESTSK |
Length | 125 |
Position | Head |
Organism | Diaphorina citri (Asian citrus psyllid) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Paraneoptera> Hemiptera> Sternorrhyncha> Psylloidea> Liviidae> Diaphorina. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.803 |
Instability index | 48.18 |
Isoelectric point | 9.07 |
Molecular weight | 14134.76 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP11802 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 80.50| 25| 38| 49| 75| 1 --------------------------------------------------------------------------- 49- 75 (37.57/30.59) LSHVETKLTEQINYLTQVSTGQPheGS 90- 114 (42.93/27.82) LEHARSRVNELERVKNKYTRGQP..GS --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) SGYASQKVLQMAWHRLEHARSRVNELERVKNKYTRGQ 2) SHVETKLTEQINYLTQVST | 75 50 | 111 68 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab