<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11800
| Description |
probable mediator of RNA polymerase II transcription subunit 36b |
| Sequence | MRPPRGRGGGGGGFRGRGDGGRGRGRGGGGGGRGGGGGRGMSRGGGRGGGRGRGGGRGGGMKGGSKVVVEPHRHEGIFIAKGKEDALVTKNMVVGESVYNEKRIAVQNEDGTKVEYRVWNPFRSKLAAAVLGGVDDIWIKPGARVLYLGAASGTTVSHVSDVVGPTGIVYAVEFSHRSGRDLVNMAKKRTNVIPIIEDARHPAKYRMLVGMVDVIFSDVAQPDQARILALNASYFLKAGGHFVISIKANCIDSTVPAEAVFASEVNKLKADQFKPTEQVTLEPFERDHACVVGIYRAPKKQKAVA |
| Length | 305 |
| Position | Unknown |
| Organism | Cucumis melo (Muskmelon) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Cucurbitales> Cucurbitaceae> Benincaseae> Cucumis.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.334 |
| Instability index | 29.00 |
| Isoelectric point | 10.21 |
| Molecular weight | 32072.25 |
| Publications | PubMed=22753475
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | methyltransferase activity GO:0008168 IEA:UniProtKB-KW
RNA binding GO:0003723 IEA:UniProtKB-KW
|
| GO - Biological Process | methylation GO:0032259 IEA:UniProtKB-KW
rRNA processing GO:0006364 IEA:UniProtKB-KW
|
Interaction
Repeat regions
| Repeats |
>MDP11800
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.13| 16| 17| 26| 41| 1
---------------------------------------------------------------------------
18- 34 (34.69/ 7.97) GDGGRGRgRGGG.GGGRG
35- 52 (31.44/ 6.69) GGGGRGMsRGGGrGGGRG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.69| 15| 17| 186| 202| 2
---------------------------------------------------------------------------
186- 202 (21.96/23.68) AKKR.....TNVipIIEDARHP
203- 222 (20.73/13.72) AKYRmlvgmVDV..IFSDVAQP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.44| 13| 16| 57| 69| 4
---------------------------------------------------------------------------
57- 69 (23.12/10.48) RGGGM...KGGSKVVV
73- 88 (17.32/ 6.11) RHEGIfiaKGKEDALV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 33.68| 12| 24| 134| 147| 5
---------------------------------------------------------------------------
134- 147 (12.32/16.93) VDDIwIKPGArVLY
159- 170 (21.36/12.02) VSDV.VGPTG.IVY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.76| 10| 17| 94| 103| 6
---------------------------------------------------------------------------
94- 103 (17.33/10.41) VGESVYNEKR
114- 123 (20.42/13.35) VEYRVWNPFR
---------------------------------------------------------------------------
|