<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11769

Description Mediator of RNA polymerase II transcription subunit 31
SequenceMASNHGLNEEAADNPSSPTNVYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQNRYLEDEAFIGYLKYLQYWQRPEYIKFIMYPHCLFFLELLQNSNFRNAMAHPGNKELAHRQQFYFWKNYRNNRLKHILPRPLPEPAALPPPVSAPPQAPVPAPTPAPTVAASPATAALSPMQYGIPPGPGLPKNDMKGAGIDRRKRKHERSMT
Length206
PositionMiddle
OrganismCucumis melo (Muskmelon)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Cucurbitales> Cucurbitaceae> Benincaseae> Cucumis.
Aromaticity0.11
Grand average of hydropathy-0.650
Instability index57.57
Isoelectric point9.16
Molecular weight23525.61
Publications
PubMed=22753475

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU364129
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription, DNA-templated	GO:0006355	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP11769
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      60.54|      16|      19|     132|     147|       1
---------------------------------------------------------------------------
  132-  147 (31.24/14.05)	PRPLPEPAALPPPVSA
  154-  169 (29.29/12.77)	PAPTPAPTVAASPATA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      75.57|      20|      27|      32|      51|       2
---------------------------------------------------------------------------
   32-   51 (36.56/22.95)	FLLELEFVQCLANPTYIHYL
   62-   81 (39.01/24.90)	FIGYLKYLQYWQRPEYIKFI
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP11769 with Med31 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MQYGIPPGPGLPKNDMKGAGIDRRKRKHERSMT
174
206










Molecular Recognition Features






MoRF SequenceStartStop




1) DMKGAGIDRRKRK
188
200