<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11768

Description pre-mRNA-processing protein 40A
SequenceMENLSQSSGGQFRPVIPAQPGQTFISSSAQQFQLAGQNISSSNVGVPAGQVQPHQYPQSMPQLVPRPGHPSYVTPSSQPIQMPYVQTRQLTSVPPQSQQNVAAPNNHMHGLGAHGVPLSSPYTFQPMSQMHAPVSVGNSQPWLSSASQTANLVSPVDQANQHSSVSAVNPAANAPVFNQQSSSDWQEHASADGRRYYYNKKTKQSSWEKPLELMTPLERADASTVWKEFTAPDGRKYYYNKVTKESKWTMPEELKLAREQAQKEATQGTQIDVSVTTPQSTPAAGLSHAETPAISSVNSSISPTVSGVATSPVPVTPFVSVSNSPSVMVTGSSAITGTPIASSTSVSGTVSSQSVAASGGTGPPAVVHANASSVTPSESLASQDVKNTVDGTSTEDIEEARKGMAVAGKVNETVLEEKSADDEPLVFANKQEAKNAFKALLESVNVQSDWTWEQAMREIINDKRYGALKTLGERKQAFHEYLGHRKKLDAEERRIRQKKAREEFTKMLEESKELTSSTRWSKAVSMFENDERFKAVERSRDREDLFESYIVELERKEKERAAEEHKKNIAEYRKFLESCDYIKVSSQWRKVQDRLEDDERCSRLEKLDRLLIFQDYIRDLEKEEEDQKKIQKERVRRIERKNRDEFRKLMEEHIAAGVFTAKTFWRDYCLKVKELPQYQAVASNTSGSTPKDLFEDVLEELENKYHEEKTQIKDVVKAAKITITSSWTFDDFKAAIEESGSLAVSDINFKLVYEDLLERAKEKEEKEAKRRQRLADDFSGLLQSFKEITTSSNWEDSKQLFEESEEYRSIGEESFAKEVFEEHITHLQEKAKEKERKREEEKAKKEKEREEKEKRKEKERKEKDREREKEKGRVKKDETDSENVDVSDTHVYREDKKRDKDKDRKHRKRHHSATDDGASDKDEREESKKSRKHGSDRKKSRKHAYSPESDSENRHRRHKRDHRDSSRRNHDELEDGELGEDGEIQ
Length985
PositionUnknown
OrganismCucumis melo (Muskmelon)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Cucurbitales> Cucurbitaceae> Benincaseae> Cucumis.
Aromaticity0.06
Grand average of hydropathy-1.085
Instability index58.10
Isoelectric point6.27
Molecular weight112109.68
Publications
PubMed=22753475

Function

Annotated function 
GO - Cellular Component
cytosol	GO:0005829	IEA:EnsemblPlants
mediator complex	GO:0016592	IEA:EnsemblPlants

GO - Biological Function
GO - Biological Process
mRNA cis splicing, via spliceosome	GO:0045292	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP11768
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             8|     432.63|      62|      66|     714|     775|       1
---------------------------------------------------------------------------
  371-  434 (42.06/19.28)	............A..SS.VTPSESL........ASQD.VKN.TVD..GTSTE........DIE....EarkgmaV.AG.K.V.....NETV.......LEEKSAD.DEPLVfANKQ..EAK
  435-  500 (65.00/34.01)	N....AFK....AllES.VNVQSDW........TWEQaMRE.IIN..DKRYG........ALK....T......LgER.KQA.....FHEY.......LGHRKKL.DAEER.RIRQ..KKA
  502-  570 (23.10/ 7.10)	...................................EE.FTK.MLE..ESKELtsstrwskAVSmfenD......E.RF.KAVersrdREDLfesyiveLER.KEK.ERAAE.EHKK..NIA
  571-  636 (58.76/30.00)	E....YRKflesC..DY.IKVSSQW........R..K.VQD.RLEddERCS.........RLE....K......L.DR.LLI.....FQDY.......I.RDLEK.EEEDQ.KKIQkeRVR
  652-  713 (56.71/28.69)	E....HIA....A..GV.FTAKTFWrdyclkvkELPQ.YQAvASN..TSGST........P.K....D......L............FEDV.......LE...EL.ENKYH.EEKT..QIK
  714-  775 (93.07/52.04)	D....VVK....A..AK.ITITSSW........TFDD.FKA.AIE..ESGSL........AVS....D......I.NF.KLV.....YEDL.......LERAKEK.EEKEA.KRRQ..RLA
  776-  843 (58.69/29.95)	DdfsgLLQ....S..FKeITTSSNW..........ED.SKQ.LFE..ESEEY.......rSIG....E......E.SFaKEV.....FEEH.......ITHLQEKaKEKER.KREE..EKA
  872-  911 (35.23/14.89)	...................................GR.VKK.DET..DSENV........DVS....D......T.H....V.....YRED.......KKRDKDK.DRKHR.KRHH.....
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     190.88|      39|      40|     175|     213|       2
---------------------------------------------------------------------------
  121-  152 (45.36/21.96)	P.YTFQPMS..QMHApvSVG......NSQPWLSSASQTANL
  175-  213 (76.87/41.86)	PVFNQQSSSDWQEHA..SADGRRYYYNKKTKQSSWEKPLEL
  216-  254 (68.65/36.67)	PLERADASTVWKEFT..APDGRKYYYNKVTKESKWTMPEEL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      36.16|      11|      15|     844|     854|       3
---------------------------------------------------------------------------
  844-  854 (20.04/10.20)	KKEKERE.EKEK
  860-  871 (16.11/ 6.62)	RKEKDRErEKEK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      54.52|      16|      19|      46|      61|       4
---------------------------------------------------------------------------
   26-   57 (19.15/ 8.67)	SSSAqqfqlagqnisssnvgVP.AGQ...VQ...PHQYP
   58-   79 (17.86/ 7.60)	QSMP..............qlVPrPGHpsyVT...PSSQP
   96-  117 (17.51/ 7.30)	QSQQ.............nvaAP.NNH...MHglgAHGVP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      74.95|      21|      24|     291|     314|       5
---------------------------------------------------------------------------
  291-  306 (22.80/ 8.55)	.........TPAISSVNSSISPTVS
  307-  330 (25.36/18.79)	GvaTSPVpvTPFV.SVSNSPSVMVT
  331-  351 (26.79/12.16)	G..SSAItgTPIASS..TSVSGTVS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      59.30|      19|      24|     919|     942|       6
---------------------------------------------------------------------------
  931-  955 (25.98/10.43)	RKHGSDRKKSRKhayspeSDSENRH
  956-  974 (33.32/14.58)	RRHKRDHRDSSR......RNHDELE
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP11768 with Med35 domain of Kingdom Viridiplantae
Unable to open file!