<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11758
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MATPPPPTTAPPGTGNFEGGPMPAAPQPPGTDMTGICFRDQLWLNTYPLDRNLVFDYFALSPFYDWTCNNEQLRMRSIHPLDLSQLSKQKRDGPEKVTPMLTYYILDGSIYQAPQLCNVFAARVSRALYYISKAFTTASSKLEKIGYVDSENESEEVKPAKETINFKEVKRVDHILASLQRKLPPAPPPPPFPEGYAPAPTADTEKGPENQQGESQQPSADPIIDQGPAKRMKF |
| Length | 234 |
| Position | Head |
| Organism | Cucumis melo (Muskmelon) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Cucurbitales> Cucurbitaceae> Benincaseae> Cucumis.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.624 |
| Instability index | 61.30 |
| Isoelectric point | 5.52 |
| Molecular weight | 26001.17 |
| Publications | PubMed=22753475
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP11758
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 117.86| 31| 181| 2| 32| 1
---------------------------------------------------------------------------
2- 32 (65.21/25.69) ATPPPP...TTAPPGTGNFEGGP..MPAAPQPPGTD
186- 221 (52.65/19.49) APPPPPfpeGYAPAPTADTEKGPenQQGESQQPSAD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.98| 14| 29| 37| 50| 2
---------------------------------------------------------------------------
37- 50 (29.10/16.40) CFRDQLWL.NTYPLD
68- 82 (21.89/10.84) CNNEQLRMrSIHPLD
---------------------------------------------------------------------------
|