Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MATPPPPTTAPPGTGNFEGGPMPAAPQPPGTDMTGICFRDQLWLNTYPLDRNLVFDYFALSPFYDWTCNNEQLRMRSIHPLDLSQLSKQKRDGPEKVTPMLTYYILDGSIYQAPQLCNVFAARVSRALYYISKAFTTASSKLEKIGYVDSENESEEVKPAKETINFKEVKRVDHILASLQRKLPPAPPPPPFPEGYAPAPTADTEKGPENQQGESQQPSADPIIDQGPAKRMKF |
Length | 234 |
Position | Head |
Organism | Cucumis melo (Muskmelon) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Cucurbitales> Cucurbitaceae> Benincaseae> Cucumis. |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.624 |
Instability index | 61.30 |
Isoelectric point | 5.52 |
Molecular weight | 26001.17 |
Publications | PubMed=22753475 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP11758 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 117.86| 31| 181| 2| 32| 1 --------------------------------------------------------------------------- 2- 32 (65.21/25.69) ATPPPP...TTAPPGTGNFEGGP..MPAAPQPPGTD 186- 221 (52.65/19.49) APPPPPfpeGYAPAPTADTEKGPenQQGESQQPSAD --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 50.98| 14| 29| 37| 50| 2 --------------------------------------------------------------------------- 37- 50 (29.10/16.40) CFRDQLWL.NTYPLD 68- 82 (21.89/10.84) CNNEQLRMrSIHPLD --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) SADPIIDQGPAKRMKF 2) VKRVDHILASLQRKLP | 219 169 | 234 184 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab