<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11743
| Description |
mediator of RNA polymerase II transcription subunit 36a-like |
| Sequence | MRPPRGRGGGGGFRGRGDGGRGGRGRGGGGGRGGGGGRGMQSRGGGRGGGRGRGGGRGGGMKGGSKVVVEPHRHEGIFIAKGKEDALVTKNMVTGESVYNEKRISVQNEDGTKIEYRVWNPFRSKLAAAVLGGVDDIWIKPGARVLYLGAASGTTVSHVSDVVGPTGIVYAVEFSHRSGRDLVNMAKKRTNVIPIIEDARHPAKYRMLVGMVDVIFSDVAQPDQARILALNASYFLKAGGHFVISIKANCIDSTVPAEAVFASEVNKLKADQFKPTEQVTLEPFERDHACVVGIYRAPKKQKAAAA |
| Length | 306 |
| Position | Unknown |
| Organism | Cucumis melo (Muskmelon) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Cucurbitales> Cucurbitaceae> Benincaseae> Cucumis.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.369 |
| Instability index | 29.45 |
| Isoelectric point | 10.21 |
| Molecular weight | 32218.35 |
| Publications | PubMed=22753475
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | methyltransferase activity GO:0008168 IEA:UniProtKB-KW
RNA binding GO:0003723 IEA:UniProtKB-KW
|
| GO - Biological Process | methylation GO:0032259 IEA:UniProtKB-KW
rRNA processing GO:0006364 IEA:UniProtKB-KW
|
Interaction
Repeat regions
| Repeats |
>MDP11743
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 84.19| 20| 24| 14| 37| 1
---------------------------------------------------------------------------
16- 37 (40.18/17.23) RGdGGRGGrGRGGGGGRGGG..GG
43- 64 (44.01/ 9.61) RG.GGRGG.GRGRGGGRGGGmkGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.27| 14| 17| 195| 208| 2
---------------------------------------------------------------------------
195- 208 (25.29/19.67) IIEDARHPAKYRML
215- 228 (23.99/18.30) IFSDVAQPDQARIL
---------------------------------------------------------------------------
|