<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11696
| Description |
cyclin-C1-2-like |
| Sequence | MAANFWTSSHYKHLLDQEDVDMVNPLDKEKGVTLEDFKLIKMQMSNYILKLAQQVKVRQRVVATAVTYMRRVYTRKSMAEYDPRLVAPTCLYLASKAEESTVQARLLVFYIKKLYADDKYRYEIKDILEMEMKILEALNYYLVVFHPYRSLSGLLQDTGLNDLSMTQLTWGLVNDTYKMDLMLVHPPHLIALACIYIASVLREKDTTVWYEELRVDMNAIKNISMEILDFYESNRMFTDERINAALHKL |
| Length | 249 |
| Position | Kinase |
| Organism | Cicer arietinum (Chickpea) (Garbanzo) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> Hologalegina> IRL clade> Cicereae> Cicer.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.150 |
| Instability index | 33.92 |
| Isoelectric point | 6.32 |
| Molecular weight | 29264.80 |
| Publications | PubMed=26259924
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | cell cycle GO:0007049 IEA:UniProtKB-KW
cell division GO:0051301 IEA:UniProtKB-KW
regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP11696
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.73| 10| 22| 60| 69| 1
---------------------------------------------------------------------------
60- 69 (17.13/10.23) RVVATAVTYM
84- 93 (18.60/11.62) RLVAPTCLYL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.76| 11| 16| 153| 163| 3
---------------------------------------------------------------------------
153- 163 (19.93/10.92) GLLQDTGLNDL
171- 181 (20.83/11.65) GLVNDTYKMDL
---------------------------------------------------------------------------
|