<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11689
| Description |
mediator of RNA polymerase II transcription subunit 19a-like |
| Sequence | MDPEGKKFGGGPRELTGAVDLINHFKLIPHYEFFCKRPLPVSIADTHYLHNVVGDTEIRKGDGMQLDQLIQNTSFFRDTSARIQPFDLDILKEAFQLRETTPIDLPAAEKGIPTIAGKSKSEKDREKKHKKHKDRDKDKDREHKKHKHRHKDRSKDKDKDKDKKKDKSGHRDSSADHSKKHHEKVDFCLFAASISFWLREKVF |
| Length | 203 |
| Position | Head |
| Organism | Cicer arietinum (Chickpea) (Garbanzo) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> Hologalegina> IRL clade> Cicereae> Cicer.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -1.177 |
| Instability index | 26.69 |
| Isoelectric point | 9.44 |
| Molecular weight | 23616.51 |
| Publications | PubMed=26259924
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP11689
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.78| 15| 15| 123| 137| 1
---------------------------------------------------------------------------
123- 137 (29.01/12.49) KDREKKHKKHKDRDK
139- 153 (28.77/12.34) KDREHKKHKHRHKDR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.26| 14| 18| 70| 87| 2
---------------------------------------------------------------------------
70- 87 (21.21/24.71) IQNTSF.FRDTSariqPFD
90- 104 (20.04/12.19) ILKEAFqLRETT....PID
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 36.91| 11| 14| 155| 165| 3
---------------------------------------------------------------------------
155- 165 (18.20/ 7.31) KDKDKDKDKKK
171- 181 (18.71/ 7.71) RDSSADHSKKH
---------------------------------------------------------------------------
|