<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11680

Description Mediator of RNA polymerase II transcription subunit 4
SequenceMLQHQIVQSPARLGLTNPNSPSILNPNPPKLPPSQTHHHQDRQFATPSAALLSLLPPLPRAQALLFQMASLASKLFEVSPNRSVWVTAFRGSLPTFLSSQSQAHSSSSLESSPSTTKEIISLFTALQTQIFEAVSELQEIIDLQDAKQKIDREIRSKDLALLAFANKLKAAERELDILVDDYSDYHRSTKRFKSGDGSEDDSLTTSTVSSQLKLSDILSYAHRISYTTFAPPEFGAGTAPLRGALPPAPQEEQMRASQLYNFADLDIGLPRAVETKEKTVEAIIEPPPIQPVDTNPLSNLSAIQGLLPPNFSVPPGWKPGMPVQLPIDIPIKPPPGWKPGDPVALPPMDSLSVSRFEEPKLPPHIPQPKQPEVIQVQHVNLDLGGSDSSDYSSDEASSDDED
Length402
PositionMiddle
OrganismCicer arietinum (Chickpea) (Garbanzo)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> Hologalegina> IRL clade> Cicereae> Cicer.
Aromaticity0.06
Grand average of hydropathy-0.398
Instability index61.88
Isoelectric point5.05
Molecular weight43863.93
Publications
PubMed=26259924

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU364141
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP11680
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      70.19|      17|      19|     308|     326|       1
---------------------------------------------------------------------------
  310-  326 (37.79/20.30)	NFSV..PPGWKPGMPVQLP
  328-  346 (32.40/10.24)	DIPIkpPPGWKPGDPVALP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.24|      14|      19|     114|     127|       2
---------------------------------------------------------------------------
  114-  127 (22.76/15.49)	STTKEIISLFTALQ
  135-  148 (22.48/15.22)	SELQEIIDLQDAKQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.20|      16|      19|     270|     287|       4
---------------------------------------------------------------------------
  270-  287 (23.68/19.78)	PraVETKE.KTVEAI..IEPP
  291-  309 (21.52/10.72)	P..VDTNPlSNLSAIqgLLPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      28.80|       7|      26|      28|      52|       6
---------------------------------------------------------------------------
   28-   35 (12.93/ 9.71)	PPkLPPSQ
   56-   62 (15.87/ 7.15)	PP.LPRAQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      70.71|      22|     203|     175|     200|       7
---------------------------------------------------------------------------
  175-  200 (31.02/36.33)	LDILVDDYSDYhrSTKRFKSGDgsED
  381-  402 (39.68/28.14)	LDLGGSDSSDY..SSDEASSDD..ED
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP11680 with Med4 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) PVQLPIDIPIKPPPGWKPGDPVALPPMDSLSVSRFEEPKLPPHIPQPKQPEVIQVQHVNLDLGGSDSSDYSSDEASSDDED
2) QSPARLGLTNPNSPSILNPNPPKLPPSQTHHHQDRQ
322
8
402
43










Molecular Recognition Features






MoRF SequenceStartStop




1) RFEEPKLPPHI
355
365