<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11665
| Description |
Mediator of RNA polymerase II transcription subunit 11 |
| Sequence | MDSQSQTTSLQRLQNVEKRIVKVLELAGGVMDELARPVGPRKDLVQSHCLEFMQLIKDIQVALREEIKSACEYRPFEKCDYGSRIANEICYKKVDYVMSQLDAMKQTIDEYHAAD |
| Length | 115 |
| Position | Head |
| Organism | Cicer arietinum (Chickpea) (Garbanzo) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> Hologalegina> IRL clade> Cicereae> Cicer.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.450 |
| Instability index | 53.28 |
| Isoelectric point | 5.42 |
| Molecular weight | 13243.09 |
| Publications | PubMed=26259924
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP11665
No repeats found
No repeats found
|