<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11661

Description pre-mRNA-processing protein 40A
SequenceMANNSQQPSGIQFRPVIHAQQGQPFVPMTSQQFGHAGHAVPSSNVGMPGQQLQYSQSMQQMAPRQIQPGHPGSSSQGIPMPYIQTNRPLTSVPQHAQQAVPHVSNHMPGLAVSGAPPQSSYTFTPSYGQQQDNANALPQYQHQPQMLAPPAGQPWPSSVSQSAAAVTSVPPAGVQSSGTASTDAATNTTNHNSASDWQEHSSADGRRYYYNKRTRQSSWEKPLELMSPLERADASTVWKEFTSSDGRKYYYNKVTQQSTWTIPEELKLAREHAHKTISQGTVSETSDTSNAAGSFAATPTAANADSFNALTSNGLASSPSSITPIAATDHQQLFSGLSGTSVSHSVVTSSATGVEPSPVVTVSTAPTTVAGSSGVAANSLDSKIPSIVENLATQDSTTSVNGAPLQDLEEAKRGLPVVGKTNVTPSEEKTNDGETLVYANKLEAKNAFKALLESVSVQSDWTWEQAMREIVNDKRYNALKTLGERKQAFNEYLGQRKKLEAEERRIKQKKAREEFTKMLEECKELTSSTRWSKAISMLESDERFSAVERPRDREDLFESYMVELERKEKENAAEEHRRNLAEYRKFLQSCDYVKVNSHWRKIQDRLEDDDRYLQLEKIDRLLVFQDYIRDLEKEEEEQKKIQKERLRRGERKNRDAFRKLLEEHVADGVLTAKTQWRDYCLKVKELPQYQAVASNTSGSTPKDLFEDVFEDLEKQYHEDKSLIKDTLKSGKITVVTTSVFEDFKSVVLEEAACQKISEINLKLLYEELLERAKEKEEKEAKKRQRLADDFTNVLYTLKDITTTSEWEDCKPLFEETQEYRSIGDESYSREIFEEYITYLKEKAKEKERKREEEKAKKEREKEEKEKRKEKEKKEKDREREKEKSKERHKKDESDSDNQDMTDSHGYREEKKKEKDKERKHRRRHQSSIEDGDSEKDEKEESRKSRRHGSDRKKSRKHANSPESDNESRHKRHKREHWDSSRRTGWHEELEDGELGDDGEV
Length1000
PositionUnknown
OrganismCicer arietinum (Chickpea) (Garbanzo)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> Hologalegina> IRL clade> Cicereae> Cicer.
Aromaticity0.07
Grand average of hydropathy-1.135
Instability index55.32
Isoelectric point6.19
Molecular weight114029.55
Publications
PubMed=26259924

Function

Annotated function
GO - Cellular Component
GO - Biological Function
GO - Biological Process
mRNA cis splicing, via spliceosome	GO:0045292	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP11661
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             5|     357.88|      65|      65|     840|     904|       1
---------------------------------------------------------------------------
  484-  542 (59.91/24.25)	...........ERK.QAF..NEYLGQ...RKKLEAEERRIKQKKAREE.........fTKM........LEECKELTSST............................RW.SKAISMlESDE
  543-  611 (61.32/24.98)	RFSAVE....RPRD.REDlfESYMVE...LERKEKENAAEEHRRNLAE..........YRKflqscdyvKVNSHWRKIQD............................RLEDDDR.......
  616-  708 (55.80/22.11)	.EKIDRllvfQDYI.RDL..EKEEEE...QKKIQKERLRRGERKNRDA..........FR...........KLLEEHVADgvltaktqwrdyclkvkelpqyqavasnTSGSTPKDL.FEDV
  840-  904 (103.59/47.00)	KEKAKE....KERK.REE..EKAKKE...REKEEKEKRKEKEKKEKDR..........ERE........KEKSKERHKKD............................ESDSDNQDM.TDSH
  910-  986 (77.26/33.29)	KKKEKD....KERKhRRR..HQSSIEdgdSEKDEKEESRKSRRHGSDRkksrkhanspESD........NESRHKRHKRE............................HWDSSRR...TGWH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     143.49|      38|      38|     194|     231|       2
---------------------------------------------------------------------------
  194-  231 (75.38/40.27)	ASD.WQEHSSADGRRYYYNKRTRQSSWEKPLELMSPLER
  234-  272 (68.11/35.76)	ASTvWKEFTSSDGRKYYYNKVTQQSTWTIPEELKLAREH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      89.69|      23|      24|     298|     320|       3
---------------------------------------------------------------------------
  298-  320 (39.10/26.38)	TPTAA..NADSFNAL..........TSNGLASS.PS
  323-  357 (23.12/12.47)	TPIAAtdHQQLFSGLsgtsvshsvvTSSATGVE.PS
  365-  386 (27.47/16.25)	APTTV..AGSS..GV..........AANSLDSKiPS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             5|     178.25|      29|      30|      20|      48|       4
---------------------------------------------------------------------------
   10-   45 (44.58/25.65)	GIqfrPvihaQQ.GQP......F..VPMTSQQF..GHAGHAVPS.....SNV
   46-   78 (34.58/18.20)	GM...PgqqlQY.SQS......M..QQMAPRQIqpGHPG..SSS.....QGI
   79-  105 (30.70/15.32)	PM...P..yiQT.NRP......LtsVPQ........HAQQAVPH.....VSN
  106-  147 (29.91/14.73)	HM...P.glaVS.GAPpqssytF..TPSYGQQQ..DNA.NALPQyqhqpQML
  148-  174 (38.47/21.10)	AP...P......aGQP......W...PSSVSQS..AAAVTSVPP.....AGV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      95.80|      36|      64|     710|     750|       5
---------------------------------------------------------------------------
  710-  750 (48.53/44.73)	EDL.....EKQYHEDKS...LIKD......TLksgKiTVVTTSVFEDFKSvVLEE
  766-  815 (47.27/27.30)	EELlerakEKEEKEAKKrqrLADDftnvlyTL...K.DITTTSEWEDCKP.LFEE
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP11661 with Med35 domain of Kingdom Viridiplantae

Unable to open file!