<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11648

Description mediator of RNA polymerase II transcription subunit 33A-like isoform X1
SequenceMESLEWNQQVNETVTNKLKLWQQLNNETPTAWVTELIQYLNSVGVELPSPEFAHLLVSQMCSENEKDHPSMWKFLHHALASRLIFPLQLLSLLSSKVFPRRYSHPHAYALFLPLLAQHAFNFHPIASIKCTNKIIKSVDSVFHFSETFKIQDVELGHVFILFFFSIFIALIDTTLNDWGIQVTFNERSCLVPTGDQYMVIDHNVTHNFKKGDYHEQIRKRNSITALEVLERLSETRKATILLQSVLLNMPENFNCLLQRLQFLESLELASSELKLVNQVLTKVSAKIRGVSHFDYCLNKHQMVRMLADVGSCTTLLRCNYRSCWIPFDIYMENAMDSRQIPIKSAIDVLKEGIKTLQIINQASWHETFLALWLSALRLVQRERDPPEGPIPHLEARLCMLLSIVPLAVLDVLRDDSEHNPSSVPVPVKSENRYEKQAVCGLMSSVQVLGQFSGLLCPPALVVDAANQAARKAASFIYNSMNEKDDSFTGIHANSNTKAGGNLRHLIVEACIARNLMDTSVYFWPGYVSTSVTSLSDSSPLEKSPWLTFMEGTPLNNSLINALTATPASSPAEIEKLYYIALNGSELERPAAAKILCGASLGRGWYIQEHVVHYVIKLLASPVPHSHSGTWGPLVDNTSMLSAVLRGASCVDTVHILSLHGVVPTVAASLLPLCEAFGSITPTPNSTGDEPSTSVYMAFSLAFLFLIRLWKFCRPPIDQCITEGGIAVGGLEYLLSLHNNWVMSSQDKLKNNQNLFDSASFKPVYIDSFPKLRALYCQYKSCVASTLSGISTGNSIHQTASVILSMIYQKMMTKGGISSSNSSSPSSNACSSLINSGEDALQRPMLPAWEVLEALPFVLEAILTACVHGRLSSRDLTTGLRDLVDFLPASLAAIIDYFSSEITRGVWKLVPMNGTDWPSPAAVLQSVESEIKAILTHVGVEVPNCSSGGSPVMLPLPMAALVSLSITFKLDKSLEYMHAITGAALENCASGCPWPSMPIIGSLWAQKVRRWHNFIVVSGSRSVFRHNNESVAQLVRSCFTSFLGILCGSTSNLTAECSVNGLLGSSITAPGACPFVAPGFLFLRSCRNIHNVQYLNDVIVGLVTEYSNELAGRRTSSGSSHLKFNEASISVAAQSVKEMATLGASLLCAAGGIQLVQELYKETIPTWLLSSRDLKRKNDSVVSYILEGYAIAYLLTLSGSIIWGVGTNLPSSKLSRRNRIIGVHLDFLAEVMERKISLSCNPITWKTYVCCLVGLIVSLAPTWVQEVKVETLRKLARGLSRWNEHELALSLLQRGGTAAMGALAELVNVIEFKHKKPCS
Length1318
PositionTail
OrganismCicer arietinum (Chickpea) (Garbanzo)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> Hologalegina> IRL clade> Cicereae> Cicer.
Aromaticity0.08
Grand average of hydropathy0.126
Instability index45.66
Isoelectric point7.20
Molecular weight145256.17
Publications
PubMed=26259924

Function

Annotated function 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process
regulation of phenylpropanoid metabolic process	GO:2000762	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP11648
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     101.54|      26|      26|     876|     901|       1
---------------------------------------------------------------------------
  876-  901 (43.15/24.60)	TTGLRDLVDF....LPASLAAIIDYFSSEI
  902-  930 (37.83/20.64)	TRGVWKLVPMngtdWP.SPAAVLQSVESEI
  945-  961 (20.56/ 7.82)	SSGGSPVM......LPLPMAALV.......
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      80.52|      25|      25|     555|     579|       2
---------------------------------------------------------------------------
  555-  579 (40.60/23.74)	NNSLINALTATPASSPAEIEKLYYI
  582-  606 (39.92/23.21)	NGSELERPAAAKILCGASLGRGWYI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     132.11|      38|     636|     418|     455|       3
---------------------------------------------------------------------------
  418-  455 (66.97/38.38)	HNPSSVPVPVKSENRYEKQAVCGLMSSVQVLGQFSGLL
 1025- 1062 (65.15/37.15)	HNNESVAQLVRSCFTSFLGILCGSTSNLTAECSVNGLL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      38.27|      12|      26|      73|      86|       4
---------------------------------------------------------------------------
   73-   86 (18.28/16.34)	KFLH.HALAsrLIFP
  101-  113 (19.99/10.55)	RYSHpHAYA..LFLP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      62.76|      21|      31|     226|     246|       7
---------------------------------------------------------------------------
  226-  246 (31.21/18.21)	LEVLERLSETRKATILLQSVL
  260-  280 (31.55/18.48)	LQFLESLELASSELKLVNQVL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      36.67|      10|      25|     785|     794|      10
---------------------------------------------------------------------------
  785-  794 (18.30/10.90)	TLSGISTGNS
  812-  821 (18.37/10.96)	TKGGISSSNS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.78|      13|      31|     366|     378|      11
---------------------------------------------------------------------------
  366-  378 (22.12/12.60)	ETFLALWLSALRL
  394-  406 (22.66/13.10)	EARLCMLLSIVPL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      85.67|      26|      31|     681|     709|      12
---------------------------------------------------------------------------
  681-  709 (41.52/33.25)	PTPNSTGDEPSTSVYmafSLAFLF.LIRLW
  714-  740 (44.15/26.57)	PPIDQCITEGGIAVG...GLEYLLsLHNNW
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP11648 with Med33 domain of Kingdom Viridiplantae
Unable to open file!