<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11647

Description heat shock cognate 70 kDa protein 2-like
SequenceMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQVAMNPVNTVFDAKRLIGRRISDASVQSDMKLWPFKVIPGPADKPMIVVNYKGEDKQFAAEEISSMVLTKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGVDFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSQGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIKDEKIGSKLSPEDKKKIDDAIEASIQWLDSNQLAEADEFEDKMKELEGLCNPIIAKMYQGGGAPDMAGGMNDDVPPSGSSGAGPKIEEVD
Length649
PositionUnknown
OrganismCicer arietinum (Chickpea) (Garbanzo)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> Hologalegina> IRL clade> Cicereae> Cicer.
Aromaticity0.06
Grand average of hydropathy-0.430
Instability index34.08
Isoelectric point5.13
Molecular weight71099.75
Publications
PubMed=26259924

Function

Annotated function 
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-KW
ATPase activity	GO:0016887	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP11647
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     109.82|      37|      47|     301|     344|       1
---------------------------------------------------------------------------
  301-  344 (53.69/52.73)	TTITRArfEELNMDLFR.....KCMEPVEKCLRDAkmdksTVHDVVLVG
  347-  388 (56.12/36.19)	TRIPKV..QQLLQDFFNgkelcKSINPDEAVAYGA.....AVQAAILSG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      85.72|      22|      26|      33|      57|       2
---------------------------------------------------------------------------
   13-   32 (24.51/ 9.25)	DLG..TTYSCVG..VWQHDRveII......
   35-   56 (42.17/27.76)	DQGNRTTPSYVG..FTDTER..LIG....D
   58-   83 (19.04/14.26)	.AKNQVAMNPVNtvF.DAKR..LIGrrisD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      70.86|      23|      44|     114|     136|       3
---------------------------------------------------------------------------
  114-  136 (37.40/24.48)	EDKQFAAEEISSMV..LTKMREIAE
  155-  179 (33.47/21.20)	NDSQRQATKDAGVIagLNVMRIINE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     108.78|      34|      44|     427|     461|       4
---------------------------------------------------------------------------
  427-  461 (52.33/34.12)	PTKKEQVFSTYSDNQPGVLiQVYEGERARTRDNNL
  474-  507 (56.45/32.79)	PRGVPQITVCFDIDANGIL.NVSAEDKTTGQKNKI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      72.43|      23|     409|     190|     212|       5
---------------------------------------------------------------------------
  190-  212 (38.68/25.28)	DKKATSVGEKNVLIFD..LGGGTFD
  216-  240 (33.75/21.12)	LTIEEGIFEVKATAGDthLGGEDFD
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP11647 with Med37 domain of Kingdom Viridiplantae
Unable to open file!