<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11646

Description mediator of RNA polymerase II transcription subunit 8-like isoform X2
SequenceMEGELVQQQQERLNQAVQQQLNLEQVKMRAISLFKAISRILEDFDAYARTNTTPKWQDILGQYSMVNLELFNIVDDIKKVSKPFLVYPKNVNADNATILPVMLSTKLLPEMETEDTSKRDQLLQGMQNLPIATQIDKLKARLDMIAGACEGAEKVLADTRKAYCFGTRQGPAIAPALDKGQAAKIQEQENLLRAAVNVGEGLRIPGDQRHITASLPMHLADVFTVNEGAQSFPEGSSNNAYMKNTPLSSNSMGGQNSLLQTSGSQLLGRSAASPNVATSATFDNTAASPIPYANSPRSSTNMMNTPSPQQQTSQQQQQQPTVQQQQRQKMMQLPQQQQQLLAQQQQFRQSAMQGLGQLHGQHQMQFSQQIGHQQFQGRQLTSGHVQHGIGQSQLNQGNQMTRISQFSGAANNALFSAAQTTPNTQMIPNISAGISSQSLLPRMQFGLSGNNPQRNHASQMLNDQMFSMGGGNPGGMMSIQQQQQQQQSSQGAFGGMASNAQNLQSGMMTLQNTQQNHPNFSQQRQQNQQ
Length529
PositionHead
OrganismCicer arietinum (Chickpea) (Garbanzo)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> Hologalegina> IRL clade> Cicereae> Cicer.
Aromaticity0.05
Grand average of hydropathy-0.673
Instability index53.91
Isoelectric point9.15
Molecular weight58137.53
Publications
PubMed=26259924

Function

Annotated function 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP11646
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      90.50|      19|      19|     315|     333|       1
---------------------------------------------------------------------------
  315-  332 (34.08/10.95)	..QQQQQPTVQQ..QQ.RQKMMQ
  333-  353 (28.61/ 7.99)	LpQQQQQLLAQQ..QQfRQSAMQ
  510-  529 (27.81/ 7.55)	L.QNTQQ.NHPNfsQQ.RQQNQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      79.02|      16|      19|     436|     452|       2
---------------------------------------------------------------------------
  264-  274 (18.47/ 6.39)	SQ.LLGR.....SAASP
  436-  452 (27.23/17.55)	SQSLLPRMqFGLSGNNP
  458-  473 (33.31/17.45)	SQMLNDQM.FSMGGGNP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      79.82|      17|      18|     365|     381|       3
---------------------------------------------------------------------------
  365-  381 (31.11/11.25)	QFSQQIGHQQF.QGRQLT
  384-  401 (25.07/ 7.77)	HVQHGIGQSQLnQGNQMT
  405-  421 (23.64/ 6.95)	QFSGAANNALF.SAAQTT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.26|      15|      18|     275|     291|       6
---------------------------------------------------------------------------
  275-  291 (20.96/18.21)	NVATSATfdNTAASPIP
  294-  308 (29.29/17.52)	NSPRSST..NMMNTPSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      59.36|      19|      19|     176|     194|       7
---------------------------------------------------------------------------
  169-  187 (29.89/19.63)	QGPAIAPALDKGQAAKIQE
  188-  206 (29.48/19.27)	QENLLRAAVNVGEGLRIPG
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP11646 with Med8 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) FTVNEGAQSFPEGSSNNAYMKNTPLSSNSMGGQNSLLQTSGSQLLGRSAASPNVATSATFDNTAASPIPYANSPRSSTNMMNTPSPQQQTSQQQQQQPTVQQQQRQKMMQLPQQQQQLLAQQQQFRQSAMQGLGQLHGQHQMQFSQQIGHQQFQGRQLTSGHVQHGIGQSQLNQGNQMTRISQFSGAANNALFSAAQTTPNTQMIPNISAGIS
2) SLLPRMQFGLSGNNPQRNHASQMLNDQMFSMGGGNPGGMMSIQQQQQQQQSSQGAFGGMASNAQNLQSGMMTLQNTQQNHPNFSQQRQQNQQ
223
438
435
529










Molecular Recognition Features






MoRF SequenceStartStop




NANANA