<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11643
Description |
Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MATATYPPPPPYYRLYKDYSQDPQSAPEPPPPIEGTYVCFGGSYTTSDVLPSLEEQGVRQLYPKGPNIDFKKELRALNGQLQLHILELADILIERPSQYARRVEEISTVFKNIHHLLNSLRPHQARANLIHILELQIERRKQAVEDIKRRREEARRILNESLATLDGH |
Length | 168 |
Position | Middle |
Organism | Cicer arietinum (Chickpea) (Garbanzo) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> Hologalegina> IRL clade> Cicereae> Cicer.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.663 |
Instability index | 94.68 |
Isoelectric point | 7.03 |
Molecular weight | 19375.80 |
Publications | PubMed=26259924
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP11643
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.81| 10| 19| 7| 16| 1
---------------------------------------------------------------------------
7- 16 (24.59/11.00) P.PPPPYYRLY
27- 37 (19.22/ 7.32) PePPPPIEGTY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 140.07| 45| 45| 61| 105| 2
---------------------------------------------------------------------------
48- 68 (22.62/10.42) ......................DVL...PSL....EEQGVRQLYPKGPNI
69- 113 (76.81/51.19) DFKKELRALNGQLQL.HILELADILIERPSQ....YARRVEEISTVFKNI
115- 153 (40.64/23.98) HLLNSLRPHQARANLiHILELQ...IERRKQavedIKRRREE........
---------------------------------------------------------------------------
|