<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11640
Description |
mediator of RNA polymerase II transcription subunit 18 isoform X5 |
Sequence | MECVVQGIIETQHVEALEILLQGLCGVQRERLRIHEICLKNGPNLGLVASEVRLLCDLEQTEPSWTVRHIGGAMRGAGAEQISVLVRTMVESKVSKNVLRMFYTLGYKLDHELLRVGFSFQFNRGAQITVTVSSVNKMLKLHATDEAVPVTPGIQMVEVTAPASAENYTEVAAAVSSFCEYLAPLLHLSKPGVSTGVVPTAAAAAASLMSDGGGTTL |
Length | 217 |
Position | Head |
Organism | Cicer arietinum (Chickpea) (Garbanzo) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> Hologalegina> IRL clade> Cicereae> Cicer.
|
Aromaticity | 0.05 |
Grand average of hydropathy | 0.240 |
Instability index | 36.39 |
Isoelectric point | 5.87 |
Molecular weight | 23246.67 |
Publications | PubMed=26259924
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP11640
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.93| 16| 42| 127| 142| 2
---------------------------------------------------------------------------
81- 102 (16.38/ 9.22) QISVLVrtmveSKVSKnVLRMF
127- 142 (27.55/19.35) QITVTV.....SSVNK.MLKLH
---------------------------------------------------------------------------
|