<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11639

Description uncharacterized protein LOC101503108 isoform X2
SequenceMDSNNWRPNQSAENNMDSSDWRGQLQPESRQRVVNKIMDTLKRHLPDSGQEGLFELWKIAQRFEEKIFTAATSQPDYLWKISLKMLTMEIKSHGTLANNIPSNQGGPSNKPPVPVNLNLMNSNNWRLNQGAEPNMDSSDWRGQLQPESRQRVVNKIMDTLKRHLPDSGQEGLFELRKIAQRFEEKIFTAATSQGTMTNNIPSNQGGPSNRPPYPR
Length215
PositionTail
OrganismCicer arietinum (Chickpea) (Garbanzo)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> Hologalegina> IRL clade> Cicereae> Cicer.
Aromaticity0.07
Grand average of hydropathy-1.000
Instability index56.16
Isoelectric point9.43
Molecular weight24555.25
Publications
PubMed=26259924

Function

Annotated function 
GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell

GO - Biological Function
chromatin DNA binding	GO:0031490	IEA:InterPro
transcription coactivator activity	GO:0003713	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP11639
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     101.55|      16|      19|      16|      31|       1
---------------------------------------------------------------------------
   16-   30 (29.70/17.50)	.......MDSSDWRGQLQPESR
   31-   49 (21.07/10.38)	QrvvnkiMDT..LKRHL.PDSG
  135-  149 (29.70/17.50)	.......MDSSDWRGQLQPESR
  150-  168 (21.07/10.38)	QrvvnkiMDT..LKRHL.PDSG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     117.28|      30|      98|      84|     114|       2
---------------------------------------------------------------------------
   84-  114 (55.75/26.89)	KMLTmEIKSHGTLANNIPSNQGGPSNKPPVP
  185-  214 (61.53/26.43)	KIFT.AATSQGTMTNNIPSNQGGPSNRPPYP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     117.44|      37|     117|       1|      65|       3
---------------------------------------------------------------------------
    1-   65 (59.58/31.20)	MDSNNWRPNQSAENNmdssdwrgqlqpesrqRVVNKImdtlkrhlpdsgQEGLFELWKIAQRFEE
  120-  184 (57.86/30.13)	MNSNNWRLNQGAEPNmdssdwrgqlqpesrqRVVNKImdtlkrhlpdsgQEGLFELRKIAQRFEE
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP11639 with Med15 domain of Kingdom Viridiplantae
Unable to open file!