<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11615
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MAGTPDASMEEILWRSPPHVQMMGGYLHSNNILFYFAESPFFDPTSNNASLAIQANYNEAFRHFVETREAFEGRLKTMQGLEFVVSYDPIQAAAQPDGRFAHDPSNIWVIRKQTRRKRAGQEDEVVVLSTYFIVGDCIYMAPSVASVVGNRILSAVTSLTSLLKTASALPSFTPSHGHTYLPPAPKHADASQPGTQSQQSKENTPLPEDAAGKAPLVGSQVVSAGSSLQDTRTLAESFSLLSRYGDEFMDEHPLVGEPGSFILSRVNDTDRTLTAKQAANVGTTAGKVGTPQVRVDTPGRASEKGATPSGTDESKMRKKKAKLGS |
| Length | 325 |
| Position | Head |
| Organism | Aspergillus carbonarius (strain ITEM 5010) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.404 |
| Instability index | 43.47 |
| Isoelectric point | 6.46 |
| Molecular weight | 35089.92 |
| Publications | PubMed=28196534
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP11615
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.85| 20| 36| 215| 234| 1
---------------------------------------------------------------------------
215- 234 (34.76/22.74) PLVGSQVVSAGSSLQDT.RTL
253- 273 (32.09/20.48) PLVGEPGSFILSRVNDTdRTL
---------------------------------------------------------------------------
|