<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11613

Description Uncharacterized protein
SequenceMNLQGSVATMPQSNMTSLQQSSMSALSGVSTAQQNMMNSLPPSSSMDSGQGNALNSLQQVPVGSNQQTPVSAPQQANMNALSSQSGVNMLQANMNSIQSNSGMLQHQHLKQQQEHQMFQNQLKQQFQHRQMQQQLMQKQQLLQHQQQQLQQLQLQAEQQLPAQLQAHQQQMPQLHQMNDVNDLKMRQGMGVKPGVFQQHLSVDSWFVMQTGFLVIKLMKEMYLPESEKIATKLLQQLDKLKMFRTMLERLISVLQISKSSISPGLKDKLFFHEKQIVNFINAYEASFCKASMDSTAAPPT
Length300
PositionTail
OrganismPrunus persica (Peach) (Amygdalus persica)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Rosales> Rosaceae> Amygdaloideae> Amygdaleae> Prunus.
Aromaticity0.04
Grand average of hydropathy-0.553
Instability index64.37
Isoelectric point9.35
Molecular weight33823.41
Publications
PubMed=23525075

Function

Annotated function 
GO - Cellular Component
GO - Biological Function
chromatin DNA binding	GO:0031490	IEA:InterPro
transcription coactivator activity	GO:0003713	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP11613
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      68.19|      20|      20|     130|     149|       1
---------------------------------------------------------------------------
   98-  117 (30.88/ 7.93)	QSNSGMLQHQHLKQQQEHQM
  130-  149 (37.31/10.95)	QMQQQLMQKQQLLQHQQQQL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      84.82|      20|      20|       9|      28|       2
---------------------------------------------------------------------------
   19-   40 (32.46/14.03)	QQSSMSALSG....vsTAQQNMMNSL
   41-   65 (23.91/ 8.54)	PPSS.SMDSGqgnalnSLQQVPVGSN
   74-   97 (28.46/11.47)	QQANMNALSS..qsgvNMLQANMNSI
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP11613 with Med15 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MNLQGSVATMPQSNMTSLQQSSMSALSGVSTAQQNMMNSLPPSSSMDSGQGNALNSLQQVPVGSNQQTPVSAPQQANMNALSSQSGVNMLQANMNSIQSNSGMLQHQHLKQQQEHQMFQNQLKQQ
1
125










Molecular Recognition Features






MoRF SequenceStartStop




NANANA