<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11613
| Description |
Uncharacterized protein |
| Sequence | MNLQGSVATMPQSNMTSLQQSSMSALSGVSTAQQNMMNSLPPSSSMDSGQGNALNSLQQVPVGSNQQTPVSAPQQANMNALSSQSGVNMLQANMNSIQSNSGMLQHQHLKQQQEHQMFQNQLKQQFQHRQMQQQLMQKQQLLQHQQQQLQQLQLQAEQQLPAQLQAHQQQMPQLHQMNDVNDLKMRQGMGVKPGVFQQHLSVDSWFVMQTGFLVIKLMKEMYLPESEKIATKLLQQLDKLKMFRTMLERLISVLQISKSSISPGLKDKLFFHEKQIVNFINAYEASFCKASMDSTAAPPT |
| Length | 300 |
| Position | Tail |
| Organism | Prunus persica (Peach) (Amygdalus persica) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Rosales> Rosaceae> Amygdaloideae> Amygdaleae> Prunus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.553 |
| Instability index | 64.37 |
| Isoelectric point | 9.35 |
| Molecular weight | 33823.41 |
| Publications | PubMed=23525075
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP11613
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.19| 20| 20| 130| 149| 1
---------------------------------------------------------------------------
98- 117 (30.88/ 7.93) QSNSGMLQHQHLKQQQEHQM
130- 149 (37.31/10.95) QMQQQLMQKQQLLQHQQQQL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 84.82| 20| 20| 9| 28| 2
---------------------------------------------------------------------------
19- 40 (32.46/14.03) QQSSMSALSG....vsTAQQNMMNSL
41- 65 (23.91/ 8.54) PPSS.SMDSGqgnalnSLQQVPVGSN
74- 97 (28.46/11.47) QQANMNALSS..qsgvNMLQANMNSI
---------------------------------------------------------------------------
|