<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11608
| Description |
Uncharacterized protein |
| Sequence | MAVDPALVQSIQAYVDAVLDLASHFITRLRRYASFCRTLASHAVTAGTGSYCNMVASPTQSSATPAISQGLISIWQGEYVEGQKARDGSYYFKRGQ |
| Length | 96 |
| Position | Tail |
| Organism | Corchorus olitorius |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Malvales> Malvaceae> Grewioideae> Apeibeae> Corchorus.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.044 |
| Instability index | 36.39 |
| Isoelectric point | 8.68 |
| Molecular weight | 10408.63 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP11608
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.17| 13| 15| 22| 36| 1
---------------------------------------------------------------------------
22- 36 (21.15/19.99) ASHFITrlRRYASFC
40- 52 (25.02/16.19) ASHAVT..AGTGSYC
---------------------------------------------------------------------------
|