<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11606
| Description |
Uncharacterized protein |
| Sequence | MILSMGGLSQISWFQFLPVESELSSLPDKSIKADQKDAATLLVLSSHLQLQKEGFLSTWTNSFVGPWDPSQGLHNPDEKIKLWLFIPGRHVSVVESAQSAVVKLRVVASGCWLAPGDSEEVAAALSQALRNRIERALLGLSYMRFGDVFSKYHPPQIEESFRRSHGYCNCVKA |
| Length | 173 |
| Position | Kinase |
| Organism | Corchorus olitorius |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Malvales> Malvaceae> Grewioideae> Apeibeae> Corchorus.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.082 |
| Instability index | 54.69 |
| Isoelectric point | 6.96 |
| Molecular weight | 19215.79 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP11606
No repeats found
|