| Description | Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MDSSQASTLGPGGSGGNGIVSSQTNDTANATPNDDPKQNLTQVINSIQKTLGLLHQLYLTVSSFNSASQLPLLQRLNSLVTELDNMSKLSEKCNIHVPMEVLNLIDDGKNPDEFTRDVLNSCIAKNQVTKGKTDAVKSFRKHLLEELEQAFPDEVESYREIRASSAAESKRLAQSQSMLPNGDVKVKPEH |
| Length | 190 |
| Position | Middle |
| Organism | Corchorus olitorius |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Malvales> Malvaceae> Grewioideae> Apeibeae> Corchorus. |
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.559 |
| Instability index | 36.73 |
| Isoelectric point | 5.38 |
| Molecular weight | 20720.94 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats | >MDP11596 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) AFPDEVESYREIRA 2) RLAQS | 150 171 | 163 175 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab