<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11592
| Description |
Putative transcription cofactor |
| Sequence | MSSNAQTANEDNGQEEAYRKITALKERYLHLLNEKYMEFTTILQRHEESRLPEPLSAEEVERTRKNKEMAERWIRVLSMRRGNIPRGPGFRIWLNCFNMLLERLLIPNLPIIPPVSLSPKRKRIYGP |
| Length | 127 |
| Position | Tail |
| Organism | Corchorus olitorius |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Malvales> Malvaceae> Grewioideae> Apeibeae> Corchorus.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.724 |
| Instability index | 62.34 |
| Isoelectric point | 9.77 |
| Molecular weight | 15032.26 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP11592
No repeats found
|