<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11578

Description Fibrillarin
SequenceMRPPRGRGGGGGFRGGRGGEGGFRGGRGGGDGGFRGGRGRGASRGGGGRGAPRGGGRGRGGGRGGGMKGGSKVVVEPHRHEGVFVAKGKEDALVTKNMVPGEAVYNEKRISVQNDDGTKVEYRVWNPFRSKLAAAILGGVDNIWIKPGAKVLYLGAASGTTVSHVSDVVGPTGVVYAVEFSHRSGRDLVNMAKKRTNVIPIIEDARHPAKYRMLVGMVDVIFSDVAQPDQARILALNASYFLKAGGHFVISIKANCIDSTVPAEAVFQSEVKKLQQEQFRPAEQVTLEPFERDHACVVGGYRMPKKQK
Length308
PositionUnknown
OrganismCorchorus capsularis (Jute)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Malvales> Malvaceae> Grewioideae> Apeibeae> Corchorus.
Aromaticity0.07
Grand average of hydropathy-0.426
Instability index34.76
Isoelectric point10.27
Molecular weight32589.75
Publications









Function






Annotated function


GO - Cellular Component
GO - Biological Function
methyltransferase activity	GO:0008168	IEA:UniProtKB-KW
RNA binding	GO:0003723	IEA:UniProtKB-KW

GO - Biological Process
methylation	GO:0032259	IEA:UniProtKB-KW
rRNA processing	GO:0006364	IEA:UniProtKB-KW









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP11578
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      67.68|      16|      17|      35|      50|       2
---------------------------------------------------------------------------
   35-   50 (35.84/11.28)	R.GGRGRGASRGGGGRG
   53-   69 (31.84/ 9.24)	RgGGRGRGGGRGGGMKG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.03|      17|      17|     192|     208|       3
---------------------------------------------------------------------------
  172-  195 (20.30/13.04)	TGVVYAVEfshrsgrDLVNMAKKR
  196-  212 (30.72/23.18)	TNVIPIIE.......DARHPAKYR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      39.76|      12|      19|     124|     135|       4
---------------------------------------------------------------------------
  124-  135 (22.55/16.29)	VWNPFRSK...LAAA
  143-  157 (17.21/10.71)	IWIKPGAKvlyLGAA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      77.00|      23|     159|      82|     106|       5
---------------------------------------------------------------------------
   82-  106 (35.72/30.20)	GVFVAKGKEDALvtKNMVPGEAVYN
  246-  268 (41.28/28.16)	GHFVISIKANCI..DSTVPAEAVFQ
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP11578 with Med36 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MRPPRGRGGGGGFRGGRGGEGGFRGGRGGGDGGFRGGRGRGASRGGGGRGAPRGGGRGRGGGRGGGMKGGSKVVVEPHRHE
1
81










Molecular Recognition Features






MoRF SequenceStartStop




1) MRPPRGRGGGGGFRGGRGGEGGFRGGRGGGDGGFRGGRGRGASRGGGGRGAPRGGGRGRGGG
1
62