<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11545
| Description |
Uncharacterized protein (Fragment) |
| Sequence | MATDNLPRRTIKVLFRSPVDSPRDSVQLIEWSPTSCPRALLIANFHGRITIWTQPSQGPAHLVRDASCWQREHEWRQDIPVA |
| Length | 82 |
| Position | Tail |
| Organism | Corchorus capsularis (Jute) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Malvales> Malvaceae> Grewioideae> Apeibeae> Corchorus.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.472 |
| Instability index | 65.70 |
| Isoelectric point | 8.94 |
| Molecular weight | 9457.67 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP11545
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.69| 17| 20| 31| 48| 1
---------------------------------------------------------------------------
31- 48 (30.38/16.03) WS.PTSCPrALLI..ANFHGR
52- 71 (27.30/10.81) WTqPSQGP.AHLVrdASCWQR
---------------------------------------------------------------------------
|