<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11543
| Description |
Uncharacterized protein |
| Sequence | MELDQLFRNASDSRGRNLHIGPFDLDLLGEAFQMRETARVELPLAEKGIPTMVSKSKAESKEKKRKHRKQKDKNKEKDKSHKKHKHHHTDIPKDKNKGKTRHHASAPEHLAKPQDKKRRYPGNEDVFDVHRPQNGQKKPAVIYWADQYAFFGFVILRILED |
| Length | 161 |
| Position | Head |
| Organism | Corchorus capsularis (Jute) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Malvales> Malvaceae> Grewioideae> Apeibeae> Corchorus.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -1.291 |
| Instability index | 41.93 |
| Isoelectric point | 9.87 |
| Molecular weight | 18847.25 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP11543
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 58.34| 11| 15| 77| 87| 1
---------------------------------------------------------------------------
61- 71 (17.05/ 6.44) KEKKRKHRKQK
77- 87 (21.53/ 9.77) KDKSHKKHKHH
93- 103 (19.75/ 8.45) KDKNKGKTRHH
---------------------------------------------------------------------------
|