<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11521
Description |
Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MATATYPPPPPYYRLYKDYLQNPKSAPEPPPPIEGTYVCFGGNYTTDDVLPSLEEQGVRQLYPKGPNIDFKKELRSLNRELQLHILELADVLVERPSQYARRVEEISLIFKNLHHLLNSLRPHQARATLIHILELQIQRRKQALEDIKRRREEAQRLLKESLGTLDG |
Length | 167 |
Position | Middle |
Organism | Corchorus olitorius |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Malvales> Malvaceae> Grewioideae> Apeibeae> Corchorus.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.674 |
Instability index | 78.51 |
Isoelectric point | 8.63 |
Molecular weight | 19405.01 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP11521
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.81| 10| 19| 7| 16| 1
---------------------------------------------------------------------------
7- 16 (24.59/ 9.85) P.PPPPYYRLY
27- 37 (19.22/ 6.60) PePPPPIEGTY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 100.05| 35| 45| 74| 111| 2
---------------------------------------------------------------------------
74- 111 (49.94/40.84) LRSLN.RELQLHILELaDVlvERPSQ....YARRVEEISLIFK
120- 159 (50.11/30.79) LRPHQaRATLIHILEL.QI..QRRKQaledIKRRREEAQRLLK
---------------------------------------------------------------------------
|