<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11512
| Description |
"Mediator complex, subunit Med6" |
| Sequence | MATPPVPPPQAAALGNFEAPPPPAMQPPGTDMTGICFRDQLWLNTYPLDRNLIFDYFALSPFYDWTCNNEQLRMRSIHPLDITHLSKMTGLEYMLSEVMEPHLFVIRKQKRDSPEKVTPMLAYYILDGSIYQAPQLCNVFAARVGRALYYISKAFTTAASKLEKIGYVDTENEKETSESKGGKETIDFKEVKRVDHILASLQRKLPPAPPPPPFPDGFIPPATAEAEKNPENQQSVVESQPPAIDPIIDQGPAKRMKF |
| Length | 258 |
| Position | Head |
| Organism | Corchorus olitorius |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Malvales> Malvaceae> Grewioideae> Apeibeae> Corchorus.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.432 |
| Instability index | 58.61 |
| Isoelectric point | 5.66 |
| Molecular weight | 28960.93 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP11512
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.88| 17| 28| 212| 228| 2
---------------------------------------------------------------------------
212- 228 (32.69/15.79) PPFPDGFIPPATAEAEK
241- 257 (32.19/15.46) PPAIDPIIDQGPAKRMK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.72| 14| 29| 36| 49| 3
---------------------------------------------------------------------------
36- 49 (29.12/19.16) CFRDQLWLNT.YPLD
67- 81 (21.60/12.44) CNNEQLRMRSiHPLD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 31.05| 9| 24| 116| 125| 4
---------------------------------------------------------------------------
116- 125 (13.78/10.36) KVTPMLaYYI
143- 151 (17.27/ 8.44) RVGRAL.YYI
---------------------------------------------------------------------------
|