<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11479
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MDSNKESDSASDTPSSPKNVYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQRPEYIKFIMYPHCLYFLELLQNANFRNAMAHPGNKELLHRQQFFFWKNHRNNRLKFILPKPPPEPVATPAPPPHAAVPPQPNLPPVPATTIAMTTAPPAPVSALSPMPYGLPPGSSHAKNEMRNSGIDRRKRKLISLALYHFPSHPVNRIDTCYLLRIYSALVLLDDWSRVPLMSGGSSWVTSGELMKEFKPPNEKN |
Length | 269 |
Position | Middle |
Organism | Corchorus olitorius |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Malvales> Malvaceae> Grewioideae> Apeibeae> Corchorus.
|
Aromaticity | 0.12 |
Grand average of hydropathy | -0.537 |
Instability index | 54.88 |
Isoelectric point | 9.11 |
Molecular weight | 30878.07 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP11479
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 87.82| 24| 27| 131| 157| 1
---------------------------------------------------------------------------
134- 157 (52.50/24.98) PPEPVA.TPAPP.PHAAVPPQP.NLPP
159- 185 (35.32/ 9.53) PATTIAmTTAPPaPVSALSPMPyGLPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 119.35| 25| 27| 31| 55| 2
---------------------------------------------------------------------------
31- 55 (44.04/23.80) FLLEL....EFVQCLANPTYIHYLAQNRY
61- 82 (39.52/20.78) FIGYL....KYLQYWQRPEYIKFIM...Y
87- 115 (35.79/18.28) YFLELlqnaNFRNAMAHPGNKELLHRQQF
---------------------------------------------------------------------------
|