<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11465
Description |
Uncharacterized protein |
Sequence | MEIESHTEPKNDPSNIVENLEGSLSKIFKIKNEFEELKYEILLPNRLRKDKFQKSDDEIFTYFDNLENPNFAQIYISSVIGLKIGLKQLSSTDESPTINITDPRTAAMSKLGSSRYNVNYLAVSKSPISQGFLLSRKSSKNSTSLLPKKFNPDYFQNSHSDNNSGNKIYELIQSQVSNKWNKSLISGDLEIFSLQKIISWFLNYKTLFTSPCDNCSRILKHEPVLGLWIPPIVRIDSKDTTHTSSSHLNFKNMNATSIHPSCAE |
Length | 264 |
Position | Tail |
Organism | Smittium culicis |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Fungi incertae sedis> Zoopagomycota> Kickxellomycotina>
Harpellomycetes> Harpellales> Legeriomycetaceae> Smittium.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.528 |
Instability index | 44.70 |
Isoelectric point | 8.28 |
Molecular weight | 30033.61 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP11465
No repeats found
|