<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11462
| Description |
Uncharacterized protein |
| Sequence | MNELFHVLDKFQKISDEIHIFLDSLEDTSYIQIYLGTVIGLKVGLYQYKSVSEQSSDLNSRFSEPRYLINFFSVGKSHLPYNYKDSSILEISQPVQNNSFGNRIYELIQSQIDSKWADILISHELQVYSLEKILHWFSSFKSLFTSPCDSCLSILIFEPKVGQMIPPLIRIEHPENKSGSGKETYCLHPACVA |
| Length | 193 |
| Position | Tail |
| Organism | Smittium mucronatum |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Fungi incertae sedis> Zoopagomycota> Kickxellomycotina>
Harpellomycetes> Harpellales> Legeriomycetaceae> Smittium.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.137 |
| Instability index | 46.30 |
| Isoelectric point | 5.60 |
| Molecular weight | 22178.03 |
| Publications | PubMed=27343289
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP11462
No repeats found
No repeats found
|