<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11445
| Description |
Uncharacterized protein |
| Sequence | MDTSRDSSNLLDTHNRLIADVLSRFRMLTMLATIQAEGERKNIEPQTVAVTGMSMQMEFEGLHTSIKDLLALSRRLKELWLFGKLGQGEGDARIQADKLQADVVRCAELLNAIQETRYAGLATAAGGKWTPMGKPEAVAAAGGAGAGTGGEGGAATATATAPTAN |
| Length | 165 |
| Position | Head |
| Organism | Colletotrichum chlorophyti |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Glomerellales> Glomerellaceae> Colletotrichum.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.175 |
| Instability index | 27.33 |
| Isoelectric point | 5.71 |
| Molecular weight | 17315.49 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP11445
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.28| 10| 14| 124| 133| 1
---------------------------------------------------------------------------
124- 133 (21.68/11.50) AAGGKWTPMG
140- 149 (18.60/ 8.89) AAGGAGAGTG
---------------------------------------------------------------------------
|