<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11440
Description |
Mediator of RNA polymerase II transcription subunit 21 |
Sequence | MADILTQLQTCLDQLATQFYATLGYLSTYHDNSPATPPPGIPNAAPALAKMSKNTTSPPVPASIAASAVAGAAAAGAAQSPVPPPTQQPGAEPGALEGEDPSLLPRPDSPRTFAARQRELARDLIIKEQQIEYLISVLPGIGASEAEQEARIRELETQLREVEKERVAKAEELKLLRGRLEDVLGAVSVGLYGDR |
Length | 195 |
Position | Middle |
Organism | Penicillium subrubescens |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.276 |
Instability index | 56.70 |
Isoelectric point | 4.84 |
Molecular weight | 20643.10 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669
ECO:0000256 RuleBase:RU366036
|
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP11440
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 80.87| 20| 20| 42| 61| 1
---------------------------------------------------------------------------
27- 48 (32.21/14.60) STYHDNSPATPPP...giPNAAP.AL
49- 71 (27.17/11.27) AKMSKNTTSPPVP..asiAASAV.AG
72- 96 (21.49/ 7.53) AAAAGAAQSP.VPpptqqPGAEPgAL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 98.21| 33| 40| 111| 143| 2
---------------------------------------------------------------------------
111- 143 (52.55/32.95) RTFAARQRELARDLIIKEQQIEYLISVLPGI.GA
153- 186 (45.66/27.88) RELETQLREVEKERVAKAEELKLLRGRLEDVlGA
---------------------------------------------------------------------------
|