<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11439

Description Mediator of RNA polymerase II transcription subunit 12
SequenceMKPHSSAGQPWGYPMRGLNGGPGRVDLAQMAGQYDPPSVSSQHSISQLQLQAQPPQPPIRQTPVVDLTASGFESHDREPPPKRPRLDVSSGSSLGDAGSTANSAEPRSTPGSAGSRPQLSWRGRPLWSFQAVMSEVPGSENRRDGASASKPPSPPPFPAQPWTNAPPEHQRNTDSSSRDPSPVKKVSTTPYRIETPSAAPIIKGDKVAGFAPWTGNHPEDILNEQTAKQGYYDRTQVSQNESNTARPALYAQLKHRTGLQMLSSVFTAALEKRQNHNAVHAPSTFKPPPRVTLTDNKREAWLRDLANSAVPLRRLSRTIPHGIRGKVLLDQCLGKWIPVARAVWLAKCVGANEIRAFKRKGTSGALAVGLEAKWVREWTTNVQQFVEGVFSAPKSNDWKAKMTYAVGLTARLFFENLLDHDHFLEWFLSSFEAASLATVPVWLLMLGIYWNNLMRYRRRGRRLAELLLEKLRQANVAKLDPLQPLIDRLSRFIKKLVHEHTSSMILPNTWDTYKDQVSSCLNLTNKVDRALFQSIAERNARVQRPRHTKQSAQRSPHQRIIRLLDSIRSAHDIVAISSACLDAVDDRAVLVSKLLEWLATPFRYGICRVYVGVRLLRKWKSSGVDVDEHILSFLTHAGINKKLNMDNVYHAISELVRSQTFSVGRYLQWLMAKGVTNYQPSGSKTATETTGDIGLIAQLPVGRLPEHVGNLRKTLMARTGFSVSDEDEMVANIKILISHRLPALFRSTMLLDTSLSSLPSDLTWAVKAEIAQWLRRSVAEYTRANATLRAMLPGALDQSVSALTPEEFYNVRDILETLGDISMLADVLKVASSSDDSTVLASVADTTNCHFDSLSVIGATMDLFRKLIDAYAGIKRFGTPSLDLMFSLIELGLRIPNELNTVAILRQDLSRMENKSVVAACSPVSDHIPDSFGEADPLFREKLDQLLLLGNVMDEPTLDTIFNMLTKHLESGEGKMKLSANDTCRYLAQLRSFQPKHFDVILARWVCSHLRSSDRSILLHILPPLIGVGCVTIRSFLSLAKRLSNSANSIPNAADLPADLVGLLVAHDEDARYLDLVSYRFQLAQQEFISRNTEEALGIVCDAAACLKSGDEKPALKYINLETSMVTLMRELLVRNPDCTSKYCLQRIDNQSSAATVVFQKALDLLLGVDSQKENVSVISEVEKLAITTDDFSLPLCQLKLQVLFHADSANEDRTNLVDAMFKTVVADSRAQKLHWVDLVALMSPDAVRQIRERAEKELFAIPLLEEPVTPQSMTSLENAKLYLTVIEELASSIPNSGTPSIALLLVEKMDTLLHKIINLQSTLNNSGENGNATSTSQGRTTFERSLAFWFSALLRMVVIHRASFIQPSPTLKIGSSHEQSRLLISIFCIALSRLPGDVLRFFPGADYFPRQGTVEDYRPCPGILLQTHALDVAASLIDIFPDEIRHHCARFLKEKCPPFVPLQNDSRFLYLLGPMSDSHPSAILQSASAPSPAASASTPTPTSANFPAGGASSQPTASSLYGGLSENSNCMANRLRLQNRGRIVGPYPIRPWELLEDAAPFVGVNDTAVNLGYFDARRVRA
Length1582
PositionKinase
OrganismPenicillium subrubescens
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium.
Aromaticity0.07
Grand average of hydropathy-0.208
Instability index46.48
Isoelectric point8.83
Molecular weight174969.02
Publications









Function






Annotated function

Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.


Component of the srb8-11 complex. The srb8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The srb8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.



ECO:0000256	ARBA:ARBA00002895
ECO:0000256	ARBA:ARBA00003744

GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP11439
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      90.76|      25|      35|     367|     394|       1
---------------------------------------------------------------------------
  367-  391 (45.37/39.50)	AVGLEAKWVREWTTNVQQFVEGVFS
  405-  429 (45.38/29.20)	AVGLTARLFFENLLDHDHFLEWFLS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.15|      13|      15|     320|     334|       2
---------------------------------------------------------------------------
  320-  334 (19.39/16.76)	PhgIRGKVLLDQCLG
  338-  350 (24.76/13.38)	P..VARAVWLAKCVG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     350.94|      72|      73|      10|      81|       3
---------------------------------------------------------------------------
   10-   81 (129.87/70.01)	PW..GYPMRGLNGGPGRVDLAQMAGQYDPPSV.SSQHS.ISQLQLQAQP...PQPPI..............RQTPVVDLTASGFESHDREP.PP
   88-  155 (72.47/35.69)	..........VSSGSSLGDAGSTANSAEPRSTpGSAGS.RPQLSWRGRPlwsFQAVM..............SEVPGSENRRDG.ASASKPPsPP
  161-  210 (65.89/31.76)	PW..T......NAPPEHQRNTDSSSR.DPSPV..KKVS.TTPYRIETPS...AAPII..............KGDKVAGF...............
  212-  289 (82.71/41.81)	PWtgNHPEDILN......EQTAKQGYYDRTQV.SQNESnTARPALYAQL...KHRTGlqmlssvftaalekRQNHNAVHAPSTF.....KP.PP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      99.27|      32|      35|     703|     737|       4
---------------------------------------------------------------------------
  703-  730 (29.71/22.12)	.........RLPehvGNLRKTLMARTGFSVSDEDEMV
  731-  756 (25.32/11.15)	ANIKILIshRLP...ALFRSTMLLDTSLS........
  887-  918 (44.24/24.80)	SLIELGL..RIP...NELNTVAILRQDLSRMENKSVV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      46.75|      14|      15|     824|     837|       5
---------------------------------------------------------------------------
  824-  837 (21.66/13.49)	LADVLKVASSSDDS
  840-  853 (25.09/16.94)	LASVADTTNCHFDS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.16|      16|      37|    1160|    1175|       6
---------------------------------------------------------------------------
 1160- 1175 (25.40/17.37)	QKALDLLLGVDSQKEN
 1198- 1213 (25.76/17.74)	QLKLQVLFHADSANED
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.42|      13|      37|    1101|    1113|       8
---------------------------------------------------------------------------
 1101- 1113 (23.38/13.46)	CDAAACLKSGDEK
 1139- 1151 (25.04/14.88)	CTSKYCLQRIDNQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      90.92|      28|      37|     609|     639|       9
---------------------------------------------------------------------------
  609-  639 (42.67/35.19)	VYVGVRLLRKWKSSGVDvdeHILSFLTHAGI
  648-  675 (48.25/31.36)	VYHAISELVRSQTFSVG...RYLQWLMAKGV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      37.76|      10|      15|     502|     511|      11
---------------------------------------------------------------------------
  502-  511 (19.89/12.16)	SSMILPNTWD
  519-  528 (17.87/10.17)	SCLNLTNKVD
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP11439 with Med12 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MKPHSSAGQPWGYPMRGLNGGPGRVDLAQMAGQYDPPSVSSQHSISQLQLQAQPPQPPIRQTPVVDLTASGFESHDREPPPKRPRLDVSSGSSLGDAGSTANSAEPRSTPGSAGSRPQLSWRGRPLWSFQAVMSEVPGSENRRDGASASKPPSPPPFPAQPWTNAPPEHQRNTDSSSRDPSPVKKVSTTPYRIETPSAAPIIKGDKVAGFAPWTGNHPEDILNEQTAKQGYYDRTQVSQNESNTARPALYA
1
251










Molecular Recognition Features






MoRF SequenceStartStop




1) WGYPMR
11
16